Ppp3r1 (BC002267) Mouse Tagged ORF Clone

CAT#: MR200485

Ppp3r1 (Myc-DDK-tagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Ppp3r1
• Synonyms: MCIP1, Cnb1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200485 representing BC002267
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200485 representing BC002267
  Red=Cloning site Green=Tags(s)
  
  MSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELF
  QVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVSE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC002267
• ORF Size: 347 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: BC002267
• RefSeq Size: 802
• RefSeq ORF: 347
• Locus ID: 19058
• MW: 29.4 kDa
• Gene Summary: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. [UniProtKB/Swiss-Prot Function]