Fxyd7 (BC061101) Mouse Tagged ORF Clone

CAT#: MR200920

  • TrueORF®

Fxyd7 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 7 (cDNA clone MGC:74220 IMAGE:6531288)


  "BC061101" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 310.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Fxyd7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Fxyd7
Synonyms 1110035I01Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200920 representing BC061101
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCCCAACCCAGAGCCCCACAAACGTTCCTGAAGAAACAGATCCTTTTTTCTATGACTATGCCA
CTGTGCAGACTGTGGGGATGACCCTGGCCACTATCATGTTCGTGCTGGGGATCATCATCATCCTGAGCAA
GAAGGTGAAGTGCAGGAAGGCGGATTCCAGCCCAACATGCAAATCCTGTAAGTCGGAACTGCCCTCCTCA
GCCCCTGGAGGTGGCGGTGTGTGGGATCCTCTGCAGATTTCCACTGCTGTCCCTGGCCAGAGTGCAGGAA
CCAGAGGACCCAGAGAAGGCGGTGGGGACCCAGCCTGGCGCCAGGGAGTGTGCCCCCAATCAGCCGCCAG
ACCCACCCCAAGGCCGGAGCCAATGCACCCCGCTCTCCCTCCCCAGGCCTTGGCAACAACGATCCTATTT
GTACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200920 representing BC061101
Red=Cloning site Green=Tags(s)

MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSSPTCKSCKSELPSS
APGGGGVWDPLQISTAVPGQSAGTRGPREGGGDPAWRQGVCPQSAARPTPRPEPMHPALPPQALATTILF
VP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC061101
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC061101.1
RefSeq Size 770
RefSeq ORF 428
Locus ID 57780
MW 28.2 kDa
Gene Summary This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.