Sit1 (NM_019436) Mouse Tagged ORF Clone

CAT#: MR201609

  • TrueORF®

Sit1 (Myc-DDK-tagged) - Mouse suppression inducing transmembrane adaptor 1 (Sit1)


  "NM_019436" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 118.00

USD 429.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (2)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Other products for "Sit1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sit1
Synonyms Sit
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201609 representing NM_019436.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAGCAGAGATTACAACTGTACCACTGACGATCAACTCGCATGGGGGATCCCCTCCATAAGCCACGCG
TGGGGACTGTGGGCCCTCTTAGGAGTTGTGACGGTGCTGCTTCTCATCTCATTGGCTGCACTCTTGTCC
CAGTGGACCCGTGGTCGGAGAAGGAACCAGGAGGGACAGGGACCACTCTCCGGAAGGTCCGCGGAAGAA
GTTCCCCTGTATGGCAACCTGCACTATTTACAGACAGGTCGGCTGTCTCAAGAACCAAGGTCAGAAGAG
CAGGACCCACCATCCTCTGGAGGCCTTGCCAGGGGGGCGGAGGAGGCCATGTGCTACACTAGCCTGCAG
CTGCGACCAGCTCAAGGTCGGATCCCCAGCTCTGGAAACCCCATCAAGTACTGTGAGGTGGTGCTGGAC
TCTGAGCCAAAGCCCCAGGCCCCAGGCCCTGAGCCGGAACTTTATGCCTCCGTGTGTGCCCAGACCCGC
AGAGGCCGGGCTTCCTTCCCAGATCAAGCCTATGCCAACAGCCAGCCTGCACCCAGC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by MR201609
Blue=ORF Red=Cloning site Green=Tag(s)

MSRDYNCTTDDQLAWGIPSISHAWGLWALLGVVTVLLLISLAALLSQWTRGRRRNQEGQGPLSGRSAEE
VPLYGNLHYLQTGRLSQEPRSEEQDPPSSGGLARGAEEAMCYTSLQLRPAQGRIPSSGNPIKYCEVVLD
SEPKPQAPGPEPELYASVCAQTRRGRASFPDQAYANSQPAPS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using MR201609 also available, TP501609
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019436
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_019436.3, NP_062309.2
RefSeq Size 1201 bp
RefSeq ORF 543 bp
Locus ID 54390
UniProt ID Q8C503
Cytogenetics 4 A5
MW 19.6 kDa
Gene Summary Negatively regulates T-cell antigen receptor (TCR)-mediated signaling. Involved in positive selection of T-cells.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.