Cldn10 (NM_001160097) Mouse Tagged ORF Clone

CAT#: MR201866

Cldn10 (Myc-DDK-tagged) - Mouse claudin 10 (Cldn10), transcript variant a_v2

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cldn10
• Synonyms: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201866 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCAGGGCACAGATCTCAGCTCTGGTGTGTGGTGTTGGAGGGTTTGGTGCTCTCGTCGCTGCCACCA
  CATCCAACGAATGGAAAGTGACCACCCGAGCGTCGTCTGTGATTACCGCCACCTGGGTTTACCAGGGTCT
  GTGGATGAACTGCGCAGGTAACGCTCTGGGCTCCTTCCACTGCCGGCCACATTTCACTATCTTCAAAGTA
  GAAGGTTACATCCAGGCATGTAGAGGACTAATGATCGCTGCGGTCAGCCTGGGATTTTTCGGTTCCATTT
  TTGCACTCTTTGGAATGAAATGTACCAAAGTCGGAGGCTCAGATCAAGCCAAAGCTAAAATCGCTTGCTT
  GGCCGGGATTGTATTCATATTGTCAGGTCTGTGTTCCATGACAGGCTGTTCCCTGTATGCAAACAAAATC
  ACAACAGAATTCTTTGATCCTCTCTATATGGAGCAAAAAATGGGCTACACATACAACGGACCCACGTCTG
  TCATGTCTTCTCGGACCAAGTATCAAGGCGGAGAAGGAGATTTTAAAACCGCAGGCCCTTCAAAACAGTT
  TGATAAAAATGCCTATGTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201866 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRAQISALVCGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKV
  EGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKI
  TTEFFDPLYMEQKMGYTYNGPTSVMSSRTKYQGGEGDFKTAGPSKQFDKNAYV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001160097
• ORF Size: 582 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001160097.1, NP_001153569.1
• RefSeq Size: 1092 bp
• RefSeq ORF: 582 bp
• Locus ID: 58187
• MW: 20.7 kDa
• Gene Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Six alternatively spliced transcript variants have been identified, which encode different isoforms with distinct electric charge of the first extracellular loop and with or without the fourth transmembrane region. These isoforms exhibit distinct localization and function in paracellular anion or cation permeability. [provided by RefSeq, Aug 2010]