Cntf (NM_170786) Mouse Tagged ORF Clone

CAT#: MR201984

Cntf (Myc-DDK-tagged) - Mouse ciliary neurotrophic factor (Cntf)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cntf
• Synonyms: AI429687
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201984 representing NM_170786
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTTTCGCAGAGCAATCACCTCTGACCCTTCACCGCCGGGACCTCTGTAGCCGCTCTATCTGGCTAG
  CAAGGAAGATTCGTTCAGACCTGACTGCTCTTATGGAATCTTATGTAAAACATCAAGGCCTGAATAAAAA
  TATCAGCCTTGACTCAGTGGATGGTGTACCAGTGGCAAGCACTGATCGCTGGAGTGAGATGACTGAGGCA
  GAGCGACTCCAAGAGAACCTCCAGGCTTACCGTACCTTCCAAGGGATGTTAACCAAGCTTTTAGAAGACC
  AGAGAGTGCATTTCACCCCGACTGAAGGTGACTTCCATCAGGCAATACATACTCTTACGCTCCAAGTTTC
  TGCCTTCGCCTACCAGCTAGAGGAGTTAATGGCGCTTCTGGAACAGAAGGTCCCTGAAAAAGAGGCTGAT
  GGGATGCCTGTCACAATTGGAGATGGTGGCCTCTTTGAGAAGAAGCTGTGGGGCTTGAAGGTCCTTCAAG
  AGCTTTCACAGTGGACTGTGAGGTCTATCCATGACCTCCGTGTCATTTCTTCTCATCACATGGGAATCTC
  AGCACATGAGAGCCATTATGGGGCCAAGCAAATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201984 representing NM_170786
  Red=Cloning site Green=Tags(s)
  
  MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEA
  ERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEAD
  GMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_170786
• ORF Size: 594 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_170786.1, NM_170786.2, NP_740756.1
• RefSeq Size: 1205 bp
• RefSeq ORF: 597 bp
• Locus ID: 12803
• MW: 23 kDa
• Gene Summary: The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes, and it may be involved in reducing tissue destruction during inflammatory attacks. A read-through transcript variant composed of Zfp91 and Cntf sequences has been identified, but it is thought to be non-coding. Read-through transcription of Zfp91 and Cntf has been observed in both human and mouse. [provided by RefSeq, Aug 2008]