Cldn2 (NM_016675) Mouse Tagged ORF Clone

CAT#: MR202768

Cldn2 (Myc-DDK-tagged) - Mouse claudin 2 (Cldn2)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cldn2
• Synonyms: AL022813
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202768 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCTCCCTTGGCGTCCAACTGGTGGGCTACATCCTAGGCCTTTTGGGGCTGTTAGGCACATCCATTG
  CCATGCTGCTTCCCAACTGGCGAACGAGTTCCTATGTTGGTGCCAGCATTGTGACGGCGGTTGGCTTTTC
  CAAGGGCCTCTGGATGGAGTGTGCGACACACAGCACAGGCATCACCCAGTGCGATATCTACAGTACCCTT
  TTAGGACTTCCTGCTGACATCCAGGCTGCCCAGGCCATGATGGTGACGTCCAGTGCAATGTCCTCGCTGG
  CTTGTATTATCTCTGTGGTGGGCATGAGATGCACCGTGTTCTGCCAGGATTCTCGAGCTAAGGACAGAGT
  GGCTGTAGTGGGTGGAGTCTTTTTCATCCTTGGTGGCATCCTGGGCTTTATCCCAGTTGCTTGGAATCTT
  CATGGCATCCTTCGGGACTTCTACTCGCCGCTGGTTCCTGACAGCATGAAATTTGAGATTGGAGAGGCTC
  TGTACTTGGGCATCATCTCAGCCCTGTTTTCTTTGGTAGCCGGAGTCATCCTTTGCTTTTCCTGCTCGCC
  CCAGGGCAATCGTACCAACTACTATGATGGCTACCAGGCCCAGCCTCTTGCCACTAGGAGCTCTCCAAGA
  TCTGCTCAACAGCCCAAAGCCAAGAGTGAGTTCAACTCATACAGCCTGACTGGGTATGTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202768 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL
  LGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNL
  HGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPR
  SAQQPKAKSEFNSYSLTGYV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016675
• ORF Size: 693 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016675.1, NM_016675.2, NM_016675.3, NM_016675.4, NP_057884.1
• RefSeq Size: 3079 bp
• RefSeq ORF: 693 bp
• Locus ID: 12738
• MW: 24.5 kDa
• Gene Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The knockout mice lacking this gene display normal appearance, activity, growth and behavior, but are defective in the leaky and cation-selective paracellular permeability properties of renal proximal tubules. The proteins encoded by this gene and another family member Cldn12 are also critical for vitamin D-dependent Ca2+ absorption between enterocytes. [provided by RefSeq, Aug 2010]