Tff1 (NM_009362) Mouse Tagged ORF Clone

CAT#: MR220970

  • TrueORF®

Tff1 (Myc-DDK-tagged) - Mouse trefoil factor 1 (Tff1)


  "NM_009362" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Tff1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tff1
Synonyms Bcei; PS2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR220970 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCACAAGGTGATCTGTGTCCTCGCTGTGGTCCTCATGCTGGCCTTCGGCAGCCTTGCCCAGGCCC
AGGCCCAGGCCCAGGCCCAGGAAGAAACATGTATCATGGCCCCCCGGGAGAGGATAAATTGTGGCTTCCC
CGGTGTCACCGCCCAGCAGTGCACGGAGAGAGGTTGCTGTTTTGATGACAGTGTCCGGGGATTCCCGTGG
TGCTTCCACCCCATGGCCATCGAGAACACTCAAGAAGAAGAATGTCCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220970 protein sequence
Red=Cloning site Green=Tags(s)

MEHKVICVLAVVLMLAFGSLAQAQAQAQAQEETCIMAPRERINCGFPGVTAQQCTERGCCFDDSVRGFPW
CFHPMAIENTQEEECPF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009362
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_009362.1, NM_009362.2, NP_033388.1
RefSeq Size 478
RefSeq ORF 264
Locus ID 21784
MW 9.7 kDa
Gene Summary Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.