Tmsb10 (NM_001190327) Mouse Tagged ORF Clone

CAT#: MR221736

  • TrueORF®

Tmsb10 (Myc-DDK-tagged) - Mouse thymosin, beta 10 (Tmsb10)


  "NM_001190327" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Tmsb10"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tmsb10
Synonyms Ptmb10; Tb10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR221736 representing NM_001190327
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACAAGCCGGACATGGGGGAAATCGCCAGCTTCGATAAGGCCAAGCTGAAGAAAACCGAGACGC
AGGAGAAGAACACCCTGCCGACCAAAGAGACCATTGAACAGGAAAAGAGGAGTGAAATCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR221736 representing NM_001190327
Red=Cloning site Green=Tags(s)

MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190327
ORF Size 135 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001190327.1, NP_001177256.1
RefSeq Size 637
RefSeq ORF 135
Locus ID 19240
MW 5 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.