Cldn19 (NM_001038590) Mouse Tagged ORF Clone

CAT#: MR225217

Cldn19 (Myc-DDK-tagged) - Mouse claudin 19 (Cldn19), transcript variant 1

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cldn19
• Synonyms: MGC141195
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR225217 representing NM_001038590
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAACTCGGGCCTCCAGCTCCTGGGCTACTTCCTAGCCTTGGGCGGCTGGGTGGGCATCATCGCCA
  GCACTGCCCTGCCACAGTGGAAGCAGTCTTCCTATGCAGGCGATGCCATCATCACTGCCGTGGGCCTCTA
  CGAAGGGCTGTGGATGTCTTGCGCCTCTCAGAGCACCGGGCAGGTGCAATGCAAACTCTACGATTCACTC
  CTGGCCCTGGACGGTCATATCCAGTCAGCACGAGCCCTGATGGTCGTGGCTGTGCTCCTGGGCTTTGTGG
  CCATGGTGCTCAGTGTCGTGGGCATGAAGTGCACTCGGGTTGGAGACAGTAACCCCACTGCCAAGAGCCG
  TGTGGCCATCTCCGGAGGTGCTCTCTTCCTCTTGGCAGGTCTCTGTACTTTGACTGCTGTCTCCTGGTAT
  GCTACCCTGGTAACACAGGAATTCTTCAACCCCAGCACTCCTGTCAATGCCAGGTACGAATTTGGCCCAG
  CTCTGTTCGTCGGCTGGGCCTCGGCCGGCCTGGCCATGCTGGGCGGTTCCTTTCTCTGCTGCACATGCCC
  AGAGCCGGAGAGGGCGAACAGCATCCCACAGCCCTATCGCTCTGGACCCTCAACTGCTGCCAGAGAACCT
  GTTGTTAAGTTGCCCGCCTCGGTCAAGGGCCCCCTGGGTGTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR225217 representing NM_001038590
  Red=Cloning site Green=Tags(s)
  
  MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL
  LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKSRVAISGGALFLLAGLCTLTAVSWY
  ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLCCTCPEPERANSIPQPYRSGPSTAAREP
  VVKLPASVKGPLGV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001038590
• ORF Size: 672 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001038590.1, NP_001033679.1
• RefSeq Size: 888 bp
• RefSeq ORF: 675 bp
• Locus ID: 242653
• Cytogenetics: 4 D2.1
• MW: 23.8 kDa
• Gene Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. siRNA knockdown of this gene in mice develops the FHHNC (familial hypomagnesemia with hypercalciuria and nephrocalcinosis) symptoms of chronic renal wasting of magnesium and calcium together with defective renal salt handling. The protein encoded by this gene interacts with another family member, Claudin 16, and their interaction is required for their assembly into tight junctions and for renal reabsorption of magnesium. This protein is a constituent of tight junctions in the Schwann cells of peripheral myelinated nerves and the gene deficiency affects the nerve conduction of peripheral myelinated fibers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2010]