Apoc3 (NM_001289833) Mouse Tagged ORF Clone

CAT#: MR227706

  • TrueORF®

Apoc3 (myc-DDK-tagged) - Mouse apolipoprotein C-III (Apoc3), transcript variant 4


  "NM_001289833" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Apoc3"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Apoc3
Synonyms apo-CIII; apoC-III
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227706 representing NM_001289833
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACAAGCCTCCAAGACGGTCCAGGATGCGCTAAGTAGCGTGCAGGAGTCCGATATAGCTGTGGTGG
CCAGGGGCTGGATGGACAATCACTTCAGATCCCTGAAAGGCTACTGGAGCAAGTTTACTGACAAGTTCAC
CGGCTTCTGGGATTCTAACCCTGAGGACCAACCAACTCCAGCTATTGAGTCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227706 representing NM_001289833
Red=Cloning site Green=Tags(s)

MEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001289833
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001289833.1, NP_001276762.1
RefSeq Size 459
RefSeq ORF 195
Locus ID 11814
MW 7.7 kDa
Gene Summary This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.