Arhgdib (NM_001301309) Mouse Tagged ORF Clone

CAT#: MR227931

  • TrueORF®

Arhgdib (myc-DDK-tagged) - Mouse Rho, GDP dissociation inhibitor (GDI) beta (Arhgdib), transcript variant 6


  "NM_001301309" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Arhgdib"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Arhgdib
Synonyms D4; Gdid4; Ly-GDI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227931 representing NM_001301309
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTTACTGGCGATCTCGAGGCCCTCAAAAAGGATACATTTGTGCTAAAGGAAGGCATTGAATACA
GGGTGAAAATTAACTTCAAAGTGAATAAGGATATTGTGTCTGGCCTGAAGTATGTTCAACACACATACCG
GACTGGCATGAGAGTGGATAAAGCCACATTCATGGTTGGCAGCTATGGGCCCCGACCAGAGGAGTACGAA
TTCCTCACTCCAGTAGAGGAAGCTCCCAAGGGCATGCTGGCCCGAGGCACTTACCACAACAAGTCCTTCT
TCACGGATGACGACAAACAGGACCACCTCACCTGGGAATGGAACCTGGCCATTAAGAAGGATTGGACAGA
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227931 representing NM_001301309
Red=Cloning site Green=Tags(s)

MDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYE
FLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301309
ORF Size 351 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001301309.1, NP_001288238.1
RefSeq Size 993
RefSeq ORF 354
Locus ID 11857
MW 14.2 kDa
Gene Summary The protein encoded by this gene is a member of the Rho guanine nucleotide dissociation inhibitor (GDI) family. This gene is expressed at high levels in hematopoietic cells. This protein is cytosolic, and dissociation of Rho from this protein is required for membrane association and activation of Rho by Guanine Nucleotide Exchange Factors (GEFs). C-terminal truncations of this gene product have been reported to promote metastasis. Multiple transcript variants and protein isoforms exist. [provided by RefSeq, Aug 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.