Bhlhe41 (NM_001271768) Mouse Tagged ORF Clone

CAT#: MR228023

Bhlhe41 (myc-DDK-tagged) - Mouse basic helix-loop-helix family, member e41 (Bhlhe41), transcript variant 2

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Bhlhe41
• Synonyms: 6430520M22Rik; Bhlhb2l; Bhlhb3; DEC2; Sharp1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228023 representing NM_001271768
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACGAAGGAATCCCTCATTTGCAAGAGAGACAGTTACTGGAACATAGGGATTTTATAGGACTGGACT
  ATTCCTCTTTGTATATGTGTAAACCCAAAAGGAGCTTGAAGCGAGACGATACCAAGGATACCTACAAGTT
  ACCGCACAGATTAATAGAAAAGAAGAGACGAGACCGAATTAATGAATGCATTGCTCAGCTGAAAGATTTA
  CTGCCCGAACATCTGAAATTGACAACACTGGGGCATTTGGAGAAAGCAGTAGTCTTGGAATTAACTTTAA
  AGCACTTGAAAGCGCTAACAGCCTTAACTGAGCAGCAGCATCAGAAGATAATTGCTTTACAGAATGTCTG
  CGGATTATATCGCTGGAATGCCCAGGAAAAGCCGAGCTCACTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228023 representing NM_001271768
  Red=Cloning site Green=Tags(s)
  
  MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDL
  LPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNVCGLYRWNAQEKPSSL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001271768
• ORF Size: 393 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001271768.1, NP_001258697.1
• RefSeq Size: 6124
• RefSeq ORF: 396
• Locus ID: 79362
• MW: 15.9 kDa
• Gene Summary: This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with Arntl or compete for E-box binding sites in the promoter of Per1 and repress Clock/Arntl's transactivation of Per1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. Defects in this gene are associated with the short sleep phenotype. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2014]