Apoc3 (NM_001289755) Mouse Tagged ORF Clone

CAT#: MR228060

Apoc3 (myc-DDK-tagged) - Mouse apolipoprotein C-III (Apoc3), transcript variant 1

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Apoc3
• Synonyms: apo-CIII; apoC-III
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228060 representing NM_001289755
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCCCTGGGGAGGAGAGGAAGGAAGGGAAGAAACAAAGAGCTGGAGGGAGAAGCTCTCACCACCCAGC
  CATCTAGCCCACAGAAGGCTTGGGACTCATGGTACGTAGGTGCCATGCAGCCCCGGACGCTCCTCACTGT
  GGCCCTCTTGGCTCTCCTGGCATCTGCCCGAGCTGAAGAGGTAGAGGGATCCTTGCTGCTGGGCTCTGTA
  CAGGGCTACATGGAACAAGCCTCCAAGACGGTCCAGGATGCGCTAAGTAGCGTGCAGGAGTCCGATATAG
  CTGTGGTGGCCAGGGGCTGGATGGACAATCACTTCAGATCCCTGAAAGGCTACTGGAGCAAGTTTACTGA
  CAAGTTCACCGGCTTCTGGGATTCTAACCCTGAGGACCAACCAACTCCAGCTATTGAGTCG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228060 representing NM_001289755
  Red=Cloning site Green=Tags(s)
  
  MPLGRRGRKGRNKELEGEALTTQPSSPQKAWDSWYVGAMQPRTLLTVALLALLASARAEEVEGSLLLGSV
  QGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRSLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001289755
• ORF Size: 411 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001289755.1, NP_001276684.1
• RefSeq Size: 631
• RefSeq ORF: 414
• Locus ID: 11814
• MW: 15.6 kDa
• Gene Summary: This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]