SNRNP25 (NM_024571) Human Tagged ORF Clone

CAT#: RC200010

SNRNP25 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25)


  "NM_024571" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "SNRNP25"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SNRNP25
Synonyms C16orf33
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200010 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGTGTTCCAGGAGGGTCTGGCTATGGTGGTGCAGGACCCGCTGCTCTGCGATCTGCCGATCCAGG
TTACTCTGGAAGAAGTCAACTCCCAAATAGCCCTAGAATACGGCCAGGCAATGACGGTCCGAGTGTGCAA
GATGGATGGAGAAGTAATGCCCGTGGTTGTAGTGCAGAGTGCCACAGTCCTGGACCTGAAGAAGGCCATC
CAGAGATACGTGCAGCTCAAGCAGGAGCGTGAAGGGGGCATTCAGCACATCAGCTGGTCCTACGTGTGGA
GGACGTACCATCTGACCTCTGCAGGAGAGAAACTCACGGAAGACAGAAAGAAGCTCCGAGACTACGGCAT
CCGGAATCGAGACGAGGTTTCCTTCATCAAAAAGCTGAGGCAAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200010 protein sequence
Red=Cloning site Green=Tags(s)

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI
QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024571
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024571.1, NM_024571.2, NM_024571.3, NP_078847.1
RefSeq Size 1103 bp
RefSeq ORF 399 bp
Locus ID 79622
Protein Families Druggable Genome
MW 15.3 kDa
Gene Summary Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.