ARL2BP (NM_012106) Human Tagged ORF Clone

CAT#: RC200198

ARL2BP (Myc-DDK-tagged)-Human ADP-ribosylation factor-like 2 binding protein (ARL2BP)

Product Images

Western blot validation of overexpression lysate (Cat# LY415976) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200198 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ARL2BP
• Synonyms: BART; BART1; RP66
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200198 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACGCCTTAGAAGGAGAGAGCTTTGCGCTGTCTTTCTCCTCCGCCTCTGATGCAGAATTTGATGCTG
  TGGTTGGATATTTAGAGGACATTATCATGGATGACGAGTTCCAGTTATTACAGAGAAATTTCATGGACAA
  GTACTACCTGGAGTTTGAAGACACAGAAGAGAATAAACTCATCTACACACCTATTTTTAATGAATACATT
  TCTTTGGTAGAAAAATACATTGAAGAACAGCTGCTGCAGCGGATTCCTGAGTTCAACATGGCAGCCTTCA
  CCACAACATTACAGCACCATAAGGATGAAGTGGCTGGTGACATATTCGACATGCTGCTCACCTTCACAGA
  TTTTCTGGCTTTTAAAGAAATGTTTTTGGACTACAGAGCAGAAAAAGAAGGCCGAGGACTGGACTTAAGC
  AGTGGCTTAGTGGTGACTTCATTGTGCAAATCATCTTCTCTGCCAGCTTCCCAGAACAATCTGCGGCAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200198 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYI
  SLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLS
  SGLVVTSLCKSSSLPASQNNLRH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_012106
• ORF Size: 489 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_012106.1, NM_012106.2, NM_012106.3, NP_036238.1
• RefSeq Size: 2100 bp
• RefSeq ORF: 492 bp
• Locus ID: 23568
• MW: 18.8 kDa
• Gene Summary: ADP-ribosylation factor (ARF)-like proteins (ARLs) comprise a functionally distinct group of the ARF family of RAS-related GTPases. The protein encoded by this gene binds to ARL2.GTP with high affinity but does not interact with ARL2.GDP, activated ARF, or RHO proteins. The lack of detectable membrane association of this protein or ARL2 upon activation of ARL2 is suggestive of actions distinct from those of the ARFs. This protein is considered to be the first ARL2-specific effector identified, due to its interaction with ARL2.GTP but lack of ARL2 GTPase-activating protein activity. [provided by RefSeq, Jul 2008]