SEC61B (NM_006808) Human Tagged ORF Clone
CAT#: RC200247
- TrueORF®
SEC61B (Myc-DDK-tagged)-Human Sec61 beta subunit (SEC61B)
"NM_006808" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SEC61B |
Synonyms | OTTHUMP00000021784; protein translocation complex beta; protein transport protein SEC61 beta subunit; Sec61 beta subunit; Sec61 complex, beta subunit |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200247 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCTGGTCCGACCCCCAGTGGCACTAACGTGGGATCCTCAGGGCGCTCTCCCAGCAAAGCAGTGGCCG CCCGGGCGGCGGGATCCACTGTCCGGCAGAGGAAAAATGCCAGCTGTGGGACAAGGAGTGCAGGCCGCAC AACCTCGGCAGGCACCGGGGGGATGTGGCGATTCTACACAGAAGATTCACCTGGGCTCAAAGTTGGCCCT GTTCCAGTATTGGTTATGAGTCTTCTGTTCATCGCTTCTGTATTTATGTTGCACATTTGGGGCAAGTACA CTCGTTCG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200247 protein sequence
Red=Cloning site Green=Tags(s) MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP VPVLVMSLLFIASVFMLHIWGKYTRS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006808 |
ORF Size | 288 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006808.1, NM_006808.2, NP_006799.1 |
RefSeq Size | 583 bp |
RefSeq ORF | 291 bp |
Locus ID | 10952 |
Domains | Sec61_beta |
Protein Families | Transmembrane |
Protein Pathways | Vibrio cholerae infection |
MW | 10 kDa |
Gene Summary | The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC115862 | SEC61B (untagged)-Human Sec61 beta subunit (SEC61B) |
USD 310.00 |
|
RG200247 | SEC61B (GFP-tagged) - Human Sec61 beta subunit (SEC61B) |
USD 460.00 |
|
RC200247L1 | Lenti ORF clone of Human Sec61 beta subunit (SEC61B), Myc-DDK-tagged |
USD 768.00 |
|
RC200247L2 | Lenti ORF clone of Human Sec61 beta subunit (SEC61B), mGFP tagged |
USD 620.00 |
|
RC200247L3 | Lenti ORF clone of Human Sec61 beta subunit (SEC61B), Myc-DDK-tagged |
USD 768.00 |
|
RC200247L4 | Lenti ORF clone of Human Sec61 beta subunit (SEC61B), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review