SEC61B (NM_006808) Human Tagged ORF Clone

CAT#: RC200247

SEC61B (Myc-DDK-tagged)-Human Sec61 beta subunit (SEC61B)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SEC61B
• Synonyms: OTTHUMP00000021784; protein translocation complex beta; protein transport protein SEC61 beta subunit; Sec61 beta subunit; Sec61 complex, beta subunit
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200247 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCTGGTCCGACCCCCAGTGGCACTAACGTGGGATCCTCAGGGCGCTCTCCCAGCAAAGCAGTGGCCG
  CCCGGGCGGCGGGATCCACTGTCCGGCAGAGGAAAAATGCCAGCTGTGGGACAAGGAGTGCAGGCCGCAC
  AACCTCGGCAGGCACCGGGGGGATGTGGCGATTCTACACAGAAGATTCACCTGGGCTCAAAGTTGGCCCT
  GTTCCAGTATTGGTTATGAGTCTTCTGTTCATCGCTTCTGTATTTATGTTGCACATTTGGGGCAAGTACA
  CTCGTTCG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200247 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP
  VPVLVMSLLFIASVFMLHIWGKYTRS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006808
• ORF Size: 288 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006808.1, NM_006808.2, NP_006799.1
• RefSeq Size: 583 bp
• RefSeq ORF: 291 bp
• Locus ID: 10952
• Domains: Sec61_beta
• Protein Families: Transmembrane
• Protein Pathways: Vibrio cholerae infection
• MW: 10 kDa
• Gene Summary: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq, Jul 2008]