LSM1 (NM_014462) Human Tagged ORF Clone
CAT#: RC200288
LSM1 (Myc-DDK-tagged)-Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1)
"NM_014462" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | LSM1 |
Synonyms | CASM; YJL124C |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200288 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACTATATGCCTGGCACCGCCAGCCTCATCGAGGACATTGACAAAAAGCACTTGGTTCTGCTTCGAG ATGGAAGGACACTTATAGGCTTTTTAAGAAGCATTGATCAATTTGCAAACTTAGTGCTACATCAGACTGT GGAGCGTATTCATGTGGGCAAAAAATACGGTGATATTCCTCGAGGGATTTTTGTGGTCAGAGGAGAAAAT GTGGTCCTACTAGGAGAAATAGACTTGGAAAAGGAGAGTGACACACCCCTCCAGCAAGTATCCATTGAAG AAATTCTAGAAGAACAAAGGGTGGAACAGCAGACCAAGCTGGAAGCAGAGAAGTTGAAAGTGCAGGCCCT GAAGGACCGAGGTCTTTCCATTCCTCGAGCAGATACTCTTGATGAGTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200288 protein sequence
Red=Cloning site Green=Tags(s) MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014462 |
ORF Size | 399 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014462.1, NM_014462.2, NP_055277.1 |
RefSeq Size | 1161 bp |
RefSeq ORF | 402 bp |
Locus ID | 27257 |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
MW | 15.2 kDa |
Gene Summary | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC125809 | LSM1 (untagged)-Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
USD 310.00 |
|
RG200288 | LSM1 (GFP-tagged) - Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
USD 460.00 |
|
RC200288L1 | Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), Myc-DDK-tagged |
USD 768.00 |
|
RC200288L2 | Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), mGFP tagged |
USD 768.00 |
|
RC200288L3 | Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), Myc-DDK-tagged |
USD 768.00 |
|
RC200288L4 | Lenti ORF clone of Human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review