DGCR6L (NM_033257) Human Tagged ORF Clone

CAT#: RC200317

DGCR6L (Myc-DDK-tagged)-Human DiGeorge syndrome critical region gene 6-like (DGCR6L)

Product Images

Western blot validation of overexpression lysate (Cat# LY409631) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200317 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified DGCR6L protein (Cat# TP300317). The protein was produced from HEK293T cells transfected with DGCR6L cDNA clone (Cat# RC200317) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DGCR6L
• Synonyms: DGCR6
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200317 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGCGCTACGCGGCCGCCTTGGAGGAGGTGGCGGACGGTGCCCGGCAGCAGGAGCGACACTACCAGT
  TGCTGTCGGCGCTACAGAGCCTGGTGAAGGAGTTGCCCAGCTCTTTCCAGCAGCGCCTGTCCTACACCAC
  GCTCAGCGACCTGGCCCTGGCGCTTCTCGACGGCACCGTGTTCGAAATCGTGCAGGGGCTACTGGAGATC
  CAGCACCTCACCGAAAAGAGCCTGTACAACCAGCGCCTGCGCCTACAGAACGAGCACCGAGTGCTCAGGC
  AGGCGCTGCGGCAGAAGCACCAGGAAGCCCAGCAGGCCTGCCGGCCCCACAACCTGCCTGTGGTTCAGGC
  GGCTCAGCAGCGAGAACTAGAGGCCGTGGAACACCGGATCCGTGAGGAGCAGCGGGCGATGGACCAGAAG
  ATCATCCTGGAGCTGGACCGGAAGGTGGCTGACCAGCAGAGCACACTGGAGAAGGCGGGGGTGGCTGGCT
  TCTACGTGACCACCAACCCACAGGAGCTGATGCTGCAGATGAACCTGCTGGAACTCATCCGAAAGCTGCA
  GCAGAGGGGCTGCCGGGCAGGGAATGCAGCCCTGGGACTGGGAGGTCCCTGGCAGTCGCCTGCTGCCCAG
  TGTGACCAGAAAGGCAGCCCTGTCCCACCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
  QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK
  IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ
  CDQKGSPVPP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_033257
• ORF Size: 660 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_033257.1, NM_033257.2, NM_033257.3, NP_150282.1
• RefSeq Size: 1217 bp
• RefSeq ORF: 663 bp
• Locus ID: 85359
• Protein Families: Druggable Genome, Transcription Factors
• MW: 24.9 kDa
• Gene Summary: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008]