VTI1B (NM_006370) Human Tagged ORF Clone

CAT#: RC201172

VTI1B (Myc-DDK-tagged)-Human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B)

Product Images

Western blot validation of overexpression lysate (Cat# LY416689) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201172 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified VTI1B protein (Cat# TP301172). The protein was produced from HEK293T cells transfected with VTI1B cDNA clone (Cat# RC201172) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: VTI1B
• Synonyms: v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201172 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCTCCTCCGCCGCCTCCTCGGAGCATTTCGAGAAGCTGCACGAGATCTTCCGCGGCCTCCATGAAG
  ACCTACAAGGGGTGCCCGAGCGGCTGCTGGGGACGGCGGGGACCGAAGAAAAGAAGAAATTGATCAGGGA
  TTTTGATGAAAAGCAACAGGAAGCAAATGAAACGCTGGCAGAGATGGAGGAGGAGCTACGTTATGCACCC
  CTGTCTTTCCGAAACCCCATGATGTCTAAGCTTCGAAACTACCGGAAGGACCTTGCTAAACTCCATCGGG
  AGGTGAGAAGCACACCTTTGACAGCCACACCTGGAGGCCGAGGAGACATGAAATATGGCATATATGCTGT
  AGAGAATGAGCATATGAATCGGCTACAGTCTCAAAGGGCAATGCTTCTGCAGGGCACTGAAAGCCTGAAC
  CGGGCCACCCAAAGTATTGAACGTTCTCATCGGATTGCCACAGAGACTGACCAGATTGGCTCAGAAATCA
  TAGAAGAGCTGGGGGAACAACGAGACCAGTTAGAACGTACCAAGAGTAGACTGGTAAACACAAGTGAAAA
  CTTGAGCAAAAGTCGGAAGATTCTCCGTTCAATGTCCAGAAAAGTGACAACCAACAAGCTGCTGCTTTCC
  ATTATCATCTTACTGGAGCTCGCCATCCTGGGAGGCCTGGTTTACTACAAATTCTTTCGCAGCCAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201172 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP
  LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN
  RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS
  IIILLELAILGGLVYYKFFRSH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006370
• ORF Size: 696 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006370.1, NM_006370.2, NP_006361.1
• RefSeq Size: 1357 bp
• RefSeq ORF: 699 bp
• Locus ID: 10490
• Domains: t_SNARE, V-SNARE
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport
• MW: 26.7 kDa
• Gene Summary: V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence. [UniProtKB/Swiss-Prot Function]