IFITM3 (NM_021034) Human Tagged ORF Clone
CAT#: RC201635
IFITM3 (Myc-DDK-tagged)-Human interferon induced transmembrane protein 3 (IFITM3)
"NM_021034" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | IFITM3 |
Synonyms | 1-8U; DSPA2b; IP15 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201635 representing NM_021034
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATCACACTGTCCAAACCTTCTTCTCTCCTGTCAACAGTGGCCAGCCCCCCAACTATGAGATGCTCA AGGAGGAGCACGAGGTGGCTGTGCTGGGGGCGCCCCACAACCCTGCTCCCCCGACGTCCACCGTGATCCA CATCCGCAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCATGAACCCC TGCTGCCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGA CCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCAT GACCATTCTGCTCATCGTCATCCCAGTGCTGATCTTCCAGGCCTATGGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201635 representing NM_021034
Red=Cloning site Green=Tags(s) MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_021034 |
ORF Size | 399 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_021034.1, NM_021034.2, NP_066362.1 |
RefSeq Size | 808 bp |
RefSeq ORF | 402 bp |
Locus ID | 10410 |
Cytogenetics | 11p15.5 |
Domains | CD225 |
Protein Families | Transmembrane |
MW | 14.5 kDa |
Gene Summary | The protein encoded by this gene is an interferon-induced membrane protein that helps confer immunity to influenza A H1N1 virus, West Nile virus, and dengue virus. Two transcript variants, only one of them protein-coding, have been found for this gene. Another variant encoding an N-terminally truncated isoform has been reported, but the full-length nature of this variant has not been determined. [provided by RefSeq, May 2012] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC112616 | IFITM3 (untagged)-Human interferon induced transmembrane protein 3 (IFITM3) |
USD 310.00 |
|
RG201635 | IFITM3 (GFP-tagged) - Human interferon induced transmembrane protein 3 (IFITM3) |
USD 460.00 |
|
RC201635L1 | Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), Myc-DDK-tagged |
USD 620.00 |
|
RC201635L2 | Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), mGFP tagged |
USD 620.00 |
|
RC201635L3 | Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), Myc-DDK-tagged |
USD 620.00 |
|
RC201635L4 | Lenti ORF clone of Human interferon induced transmembrane protein 3 (IFITM3), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review