SF3B14 (SF3B6) (NM_016047) Human Tagged ORF Clone

CAT#: RC201866

SF3B14 (Myc-DDK-tagged)-Human splicing factor 3B, 14 kDa subunit (SF3B14)

Product Images

Western blot validation of overexpression lysate (Cat# LY414228) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201866 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SF3B6
• Synonyms: CGI-110; HSPC175; Ht006; P14; SAP14; SAP14a; SF3B14; SF3B14a
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201866 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGATGCAAGCGGCCAAGAGGGCGAACATTCGACTTCCACCTGAAGTAAATCGGATATTGTATATAA
  GAAATTTGCCATACAAAATCACAGCTGAAGAAATGTATGATATATTTGGGAAATATGGACCTATTCGTCA
  AATCAGAGTGGGGAACACACCTGAAACTAGAGGAACAGCTTATGTGGTCTATGAGGACATCTTTGATGCC
  AAGAATGCATGTGATCACCTATCGGGATTCAATGTTTGTAACAGATACCTTGTGGTTTTGTACTATAATG
  CCAACAGGGCATTTCAGAAGATGGACACAAAGAAGAAGGAGGAACAGTTGAAGCTTCTCAAGGAGAAATA
  TGGCATCAACACAGATCCACCAAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201866 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDA
  KNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016047
• ORF Size: 375 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016047.1, NM_016047.2, NM_016047.3, NP_057131.1
• RefSeq Size: 783 bp
• RefSeq ORF: 378 bp
• Locus ID: 51639
• Domains: RRM
• Protein Pathways: Spliceosome
• MW: 14.6 kDa
• Gene Summary: This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. [provided by RefSeq, Jul 2008]