Gemin 6 (GEMIN6) (NM_024775) Human Tagged ORF Clone

CAT#: RC202296

GEMIN6 (Myc-DDK-tagged)-Human gem (nuclear organelle) associated protein 6 (GEMIN6)

Product Images

Western blot validation of overexpression lysate (Cat# LY411066) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202296 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified GEMIN6 protein (Cat# TP302296). The protein was produced from HEK293T cells transfected with GEMIN6 cDNA clone (Cat# RC202296) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GEMIN6
• Synonyms: FLJ23459
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202296 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTGAATGGATGAAGAAAGGCCCCTTAGAATGGCAAGATTACATTTACAAAGAGGTCCGAGTGACAG
  CCAGTGAGAAGAATGAGTATAAAGGATGGGTTTTAACTACAGACCCAGTCTCTGCCAATATTGTCCTTGT
  GAACTTCCTTGAAGATGGCAGCATGTCTGTGACCGGAATTATGGGACATGCTGTGCAGACTGTTGAAACT
  ATGAATGAAGGGGACCATAGAGTGAGGGAGAAGCTGATGCATTTGTTCACGTCTGGAGACTGCAAAGCAT
  ACAGCCCAGAGGATCTGGAAGAGAGAAAGAACAGCCTAAAGAAATGGCTTGAGAAGAACCACATCCCCAT
  CACTGAACAGGGAGACGCTCCAAGGACTCTCTGTGTGGCTGGGGTCCTGACTATAGACCCACCATATGAT
  CCAGAAAATTGCAGCAGCTCTAATGAGATTATTCTGTCGCGTGTTCAGGATCTTATTGAAGGACATCTTA
  CAGCTTCCCAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202296 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVET
  MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYD
  PENCSSSNEIILSRVQDLIEGHLTASQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_024775
• ORF Size: 501 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_024775.2, NM_024775.4, NM_024775.6, NM_024775.8, NM_024775.9, NP_079051.9
• RefSeq Size: 705 bp
• RefSeq ORF: 504 bp
• Locus ID: 79833
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• MW: 18.9 kDa
• Gene Summary: GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005). [supplied by OMIM, Jul 2002]