KCNMB4 (NM_014505) Human Tagged ORF Clone
CAT#: RC202318
KCNMB4 (Myc-DDK-tagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4)
"NM_014505" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | KCNMB4 |
Synonyms | calcium-activated potassium channel beta 4 subunit; large conductance calcium-dependent potassium ion channel beta 4 subunit; potassium large conductance calcium-activated channel, subfamily M, beta member 4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202318 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGAAGCTCCGGGTGGCTTACGAGTACACGGAAGCCGAGGACAAGAGCATCCGGCTCGGCTTGTTTC TCATCATCTCCGGCGTCGTGTCGCTCTTCATCTTCGGCTTCTGCTGGCTGAGTCCCGCGCTGCAGGATCT GCAAGCCACGGAGGCCAATTGCACGGTGCTGTCGGTGCAGCAGATCGGCGAGGTGTTCGAGTGCACCTTC ACCTGTGGCGCCGACTGCAGGGGCACCTCGCAGTACCCCTGCGTCCAGGTCTACGTGAACAACTCTGAGT CCAACTCTAGGGCGCTGCTGCACAGCGACGAGCACCAGCTCCTGACCAACCCCAAGTGCTCCTATATCCC TCCCTGTAAGAGAGAAAATCAGAAGAATTTGGAAAGTGTCATGAATTGGCAACAGTACTGGAAAGATGAG ATTGGTTCCCAGCCATTTACTTGCTATTTTAATCAACATCAAAGACCAGATGATGTGCTTCTGCATCGCA CTCATGATGAGATTGTCCTCCTGCATTGCTTCCTCTGGCCCCTGGTGACATTTGTGGTGGGCGTTCTCAT TGTGGTCCTGACCATCTGTGCCAAGAGCTTGGCGGTCAAGGCGGAAGCCATGAAGAAGCGCAAGTTCTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202318 protein sequence
Red=Cloning site Green=Tags(s) MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEVFECTF TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDE IGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVKAEAMKKRKFS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014505 |
ORF Size | 630 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014505.1, NM_014505.2, NM_014505.3, NM_014505.4, NM_014505.5, NP_055320.4 |
RefSeq Size | 4725 bp |
RefSeq ORF | 633 bp |
Locus ID | 27345 |
Cytogenetics | 12q15 |
Domains | CaKB |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Protein Pathways | Vascular smooth muscle contraction |
MW | 23.9 kDa |
Gene Summary | MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC108188 | KCNMB4 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4) |
USD 310.00 |
|
RG202318 | KCNMB4 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4) |
USD 460.00 |
|
RC202318L1 | Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), Myc-DDK-tagged |
USD 768.00 |
|
RC202318L2 | Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), mGFP tagged |
USD 620.00 |
|
RC202318L3 | Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), Myc-DDK-tagged |
USD 620.00 |
|
RC202318L4 | Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review