Prostaglandin E Synthase (PTGES) (NM_004878) Human Tagged ORF Clone

CAT#: RC202405

PTGES (Myc-DDK-tagged)-Human prostaglandin E synthase (PTGES)

Product Images

Coomassie blue staining of purified PTGES protein (Cat# TP302405). The protein was produced from HEK293T cells transfected with PTGES cDNA clone (Cat# RC202405) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PTGES
• Synonyms: MGST-IV; MGST1-L1; MGST1L1; MPGES; mPGES-1; PGES; PIG12; PP102; PP1294; TP53I12
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202405 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCTGCCCACAGCCTGGTGATGAGCAGCCCGGCCCTCCCGGCCTTCCTGCTCTGCAGCACGCTGCTGG
  TCATCAAGATGTACGTGGTGGCCATCATCACGGGCCAAGTGAGGCTGCGGAAGAAGGCCTTTGCCAACCC
  CGAGGATGCCCTGAGACACGGAGGCCCCCAGTATTGCAGGAGCGACCCCGACGTGGAACGCTGCCTCAGG
  GCCCACCGGAACGACATGGAGACCATCTACCCCTTCCTTTTCCTGGGCTTCGTCTACTCCTTTCTGGGTC
  CTAACCCTTTTGTCGCCTGGATGCACTTCCTGGTCTTCCTCGTGGGCCGTGTGGCACACACCGTGGCCTA
  CCTGGGGAAGCTGCGGGCACCCATCCGCTCCGTGACCTACACCCTGGCCCAGCTCCCCTGCGCCTCCATG
  GCTCTGCAGATCCTCTGGGAAGCGGCCCGCCACCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202405 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR
  AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM
  ALQILWEAARHL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004878
• ORF Size: 456 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_004878.1, NM_004878.2, NM_004878.3, NM_004878.4, NP_004869.1
• RefSeq Size: 1787 bp
• RefSeq ORF: 459 bp
• Locus ID: 9536
• Cytogenetics: 9q34.11
• Domains: MAPEG
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways
• MW: 17.1 kDa
• Gene Summary: The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]