CKLF (NM_016951) Human Tagged ORF Clone

CAT#: RC202522

CKLF (Myc-DDK-tagged)-Human chemokine-like factor (CKLF), transcript variant 1

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CKLF
• Synonyms: C32; CKLF1; CKLF2; CKLF3; CKLF4; HSPC224; UCK-1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202522 representing NM_016951
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATAACGTGCAGCCGAAAATAAAACATCGCCCCTTCTGCTTCAGTGTGAAAGGCCACGTGAAGATGC
  TGCGGCTGGCACTAACTGTGACATCTATGACCTTTTTTATCATCGCACAAGCCCCTGAACCATATATTGT
  TATCACTGGATTTGAAGTCACCGTTATCTTATTTTTCATACTTTTATATGTACTCAGACTTGATCGATTA
  ATGAAGTGGTTATTTTGGCCTTTGCTTGATATTATCAACTCACTGGTAACAACAGTATTCATGCTCATCG
  TATCTGTGTTGGCACTGATACCAGAAACCACAACATTGACAGTTGGTGGAGGGGTGTTTGCACTTGTGAC
  AGCAGTATGCTGTCTTGCCGACGGGGCCCTTATTTACCGGAAGCTTCTGTTCAATCCCAGCGGTCCTTAC
  CAGAAAAAGCCTGTGCATGAAAAAAAAGAAGTTTTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202522 representing NM_016951
  Red=Cloning site Green=Tags(s)
  
  MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRL
  MKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPY
  QKKPVHEKKEVL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016951
• ORF Size: 456 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_016951.1, NM_016951.2, NM_016951.3, NP_058647.1
• RefSeq Size: 888
• RefSeq ORF: 459
• Locus ID: 51192
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• MW: 17.2 kDa
• Gene Summary: The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CMTM1 (CKLF-like MARVEL transmembrane domain containing 1). [provided by RefSeq, Feb 2011]