VAMP4 (NM_003762) Human Tagged ORF Clone

CAT#: RC202734

VAMP4 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 4 (VAMP4), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY418448) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202734 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified VAMP4 protein (Cat# TP302734). The protein was produced from HEK293T cells transfected with VAMP4 cDNA clone (Cat# RC202734) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: VAMP4
• Synonyms: VAMP-4; VAMP24
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202734 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCTCCCAAGTTTAAGCGCCACCTCAATGATGATGATGTCACAGGTTCTGTGAAAAGTGAAAGGAGAA
  ATCTTTTGGAAGATGATTCAGATGAAGAAGAGGACTTTTTTCTGGGACCATCTGGACCAAGATTTGGACC
  TAGAAATGATAAAATTAAGCATGTTCAGAATCAAGTGGATGAAGTTATTGATGTCATGCAAGAAAATATT
  ACAAAGGTAATTGAGAGAGGGGAGAGACTAGATGAACTACAGGACAAATCAGAAAGCTTATCGGATAATG
  CAACAGCTTTTAGCAACAGATCCAAACAACTTCGAAGGCAAATGTGGTGGCGTGGATGCAAAATAAAAGC
  CATCATGGCTTTGGTTGCTGCTATCCTTTTGCTAGTGATTATCATTCTTATAGTCATGAAATACCGTACT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202734 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENI
  TKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003762
• ORF Size: 363 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003762.1, NM_003762.2, NM_003762.3, NM_003762.4, NP_003753.2
• RefSeq Size: 5155 bp
• RefSeq ORF: 426 bp
• Locus ID: 8674
• Domains: synaptobrevin
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport
• MW: 16.2 kDa
• Gene Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]