CCDC115 (NM_032357) Human Tagged ORF Clone

CAT#: RC202967

CCDC115 (Myc-DDK-tagged)-Human coiled-coil domain containing 115 (CCDC115)

Product Images

Western blot validation of overexpression lysate (Cat# LY410194) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202967 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CCDC115 protein (Cat# TP302967). The protein was produced from HEK293T cells transfected with CCDC115 cDNA clone (Cat# RC202967) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CCDC115
• Synonyms: ccp1; CDG2O
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202967 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGCGCTTGACCTGCGAGCGGAGCTGGATTCGCTGGTCCTGCAGCTGCTTGGGGACCTGGAGGAGC
  TGGAGGGGAAACGAACGGTGTTGAACGCCCGGGTGGAGGAGGGCTGGCTCTCGCTCGCCAAGGCTCGCTA
  CGCGATGGGCGCCAAGTCGGTAGGGCCCCTGCAGTATGCTTCCCACATGGAGCCCCAGGTCTGCCTCCAC
  GCCAGCGAGGCCCAGGAGGGACTCCAGAAGTTCAAGGTGGTGAGAGCTGGTGTCCACGCCCCAGAGGAGG
  TGGGGCCTCGCGAAGCAGGTCTGCGGAGGCGCAAGGGCCCCACTAAGACCCCAGAACCGGAGTCCTCTGA
  GGCCCCTCAGGACCCCCTGAACTGGTTTGGAATCCTAGTTCCTCACAGTCTACGTCAGGCTCAAGCAAGC
  TTCCGGGATGGCCTGCAGCTGGCCGCAGACATAGCCAGCCTCCAGAACCGCATTGACTGGGGTCGAAGCC
  AGCTCCGGGGACTCCAAGAGAAACTCAAGCAGCTGGAGCCTGGGGCTGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202967 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALDLRAELDSLVLQLLGDLEELEGKRTVLNARVEEGWLSLAKARYAMGAKSVGPLQYASHMEPQVCLH
  ASEAQEGLQKFKVVRAGVHAPEEVGPREAGLRRRKGPTKTPEPESSEAPQDPLNWFGILVPHSLRQAQAS
  FRDGLQLAADIASLQNRIDWGRSQLRGLQEKLKQLEPGAA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032357
• ORF Size: 540 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032357.2, NM_032357.3, NP_115733.2
• RefSeq Size: 2000 bp
• RefSeq ORF: 543 bp
• Locus ID: 84317
• MW: 19.8 kDa
• Gene Summary: The protein encoded by this gene has been observed to localize to the endoplasmic reticulum (ER)-Golgi intermediate compartment (ERGIC) and coat protein complex I (COPI) vesicles in some human cells. The encoded protein shares some homology with the yeast V-ATPase assembly factor Vma22p, and the orthologous protein in mouse promotes cell proliferation and suppresses cell death. Defects in this gene are a cause of congenital disorder of glycosylation, type IIo in humans. [provided by RefSeq, Mar 2016]