LSM2 (NM_021177) Human Tagged ORF Clone

CAT#: RC203460

LSM2 (Myc-DDK-tagged)-Human LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM2)

Product Images

Western blot validation of overexpression lysate (Cat# LY412045) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203460 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LSM2
• Synonyms: C6orf28; G7B; snRNP; YBL026W
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203460 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTCTTCTATTCTTTTTTCAAGTCCCTTGTGGGCAAGGATGTGGTCGTGGAACTAAAGAATGACCTGA
  GCATCTGTGGAACCCTCCATTCTGTGGATCAGTATCTCAACATCAAACTAACTGACATCAGTGTCACAGA
  CCCTGAGAAATACCCTCACATGTTATCAGTGAAGAACTGCTTCATTCGGGGCTCAGTGGTCCGATACGTG
  CAGCTGCCAGCAGATGAGGTCGACACACAGTTGCTACAGGATGCGGCAAGGAAGGAAGCCCTGCAGCAGA
  AACAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203460 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYV
  QLPADEVDTQLLQDAARKEALQQKQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021177
• ORF Size: 285 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021177.1, NM_021177.2, NM_021177.3, NM_021177.4, NP_067000.1
• RefSeq Size: 880 bp
• RefSeq ORF: 288 bp
• Locus ID: 57819
• Domains: Sm
• Protein Pathways: RNA degradation, Spliceosome
• MW: 10.8 kDa
• Gene Summary: This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 19. [provided by RefSeq, Nov 2011]