ATP6V0C (NM_001694) Human Tagged ORF Clone
CAT#: RC203652
ATP6V0C (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1
"NM_001694" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ATP6V0C |
Synonyms | ATP6C; ATP6L; ATPL; VATL; Vma3; VPPC |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203652 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGAGTCCAAGAGCGGCCCCGAGTATGCTTCGTTTTTCGCCGTCATGGGCGCCTCGGCCGCCATGG TCTTCAGCGCCCTGGGCGCTGCCTATGGCACAGCCAAGAGCGGTACCGGCATTGCGGCCATGTCTGTCAT GCGGCCGGAGCAGATCATGAAGTCCATCATCCCAGTGGTCATGGCTGGCATCATCGCCATCTACGGCCTG GTGGTGGCAGTCCTCATCGCCAACTCCCTGAATGACGACATCAGCCTCTACAAGAGCTTCCTCCAGCTGG GCGCCGGCCTGAGCGTGGGCCTGAGCGGCCTGGCAGCCGGCTTTGCCATCGGCATCGTGGGGGACGCTGG CGTGCGGGGCACCGCCCAGCAGCCCCGACTATTCGTGGGCATGATCCTGATTCTCATCTTCGCCGAGGTG CTCGGCCTCTACGGTCTCATCGTCGCCCTCATCCTCTCCACAAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203652 protein sequence
Red=Cloning site Green=Tags(s) MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGL VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEV LGLYGLIVALILSTK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001694 |
ORF Size | 465 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001694.1, NM_001694.2, NM_001694.3, NP_001685.1 |
RefSeq Size | 1180 bp |
RefSeq ORF | 468 bp |
Locus ID | 527 |
Cytogenetics | 16p13.3 |
Domains | ATP-synt_C |
Protein Families | Transmembrane |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
MW | 15.7 kDa |
Gene Summary | 'This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC119084 | ATP6V0C (untagged)-Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1 |
USD 310.00 |
|
RG203652 | ATP6V0C (GFP-tagged) - Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1 |
USD 460.00 |
|
RC203652L1 | Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, Myc-DDK-tagged |
USD 768.00 |
|
RC203652L2 | Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, mGFP tagged |
USD 620.00 |
|
RC203652L3 | Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, Myc-DDK-tagged |
USD 620.00 |
|
RC203652L4 | Lenti ORF clone of Human ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (ATP6V0C), transcript variant 1, mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review