CIDE C (CIDEC) (NM_022094) Human Tagged ORF Clone

CAT#: RC203686

CIDEC (Myc-DDK-tagged)-Human cell death-inducing DFFA-like effector c (CIDEC), transcript variant 3

Product Images

Western blot validation of overexpression lysate (Cat# LY402906) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203686 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CIDEC
• Synonyms: CIDE-3; CIDE3; FPLD5; FSP27
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203686 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAATACGCCATGAAGTCCCTTAGCCTTCTGTACCCCAAGTCCCTCTCCAGGCATGTGTCAGTGCGTA
  CCTCTGTGGTGACCCAGCAGCTGCTGTCGGAGCCCAGCCCCAAGGCCCCCAGGGCCCGGCCCTGCCGCGT
  AAGCACGGCGGATCGAAGCGTGAGGAAGGGCATCATGGCTTACAGTCTTGAGGACCTCCTCCTCAAGGTC
  CGGGACACTCTGATGCTGGCAGACAAGCCCTTCTTCCTGGTGCTGGAGGAAGATGGCACAACTGTAGAGA
  CAGAAGAGTACTTCCAAGCCCTGGCAGGGGATACAGTGTTCATGGTCCTCCAGAAGGGGCAGAAATGGCA
  GCCCCCATCAGAACAGGGGACAAGGCACCCACTGTCCCTCTCCCATAAGCCTGCCAAGAAGATTGATGTG
  GCCCGTGTAACGTTTGATCTGTACAAGCTGAACCCACAGGACTTCATTGGCTGCCTGAACGTGAAGGCGA
  CTTTTTATGATACATACTCCCTTTCCTATGATCTGCACTGCTGTGGGGCCAAGCGCATCATGAAGGAAGC
  TTTCCGCTGGGCCCTCTTCAGCATGCAGGCCACAGGCCACGTACTGCTTGGCACCTCCTGTTACCTGCAG
  CAGCTCCTCGATGCTACGGAGGAAGGGCAGCCCCCCAAGGGCAAGGCCTCATCCCTTATCCCGACCTGTC
  TGAAGATACTGCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203686 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKV
  RDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDV
  ARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQ
  QLLDATEEGQPPKGKASSLIPTCLKILQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_022094
• ORF Size: 714 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_022094.2, NM_022094.3, NP_071377.2
• RefSeq Size: 1298 bp
• RefSeq ORF: 717 bp
• Locus ID: 63924
• Protein Families: Druggable Genome
• MW: 26.8 kDa
• Gene Summary: This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]