HOXD4 (NM_014621) Human Tagged ORF Clone

CAT#: RC204747

HOXD4 (Myc-DDK-tagged)-Human homeobox D4 (HOXD4)

Product Images

Western blot validation of overexpression lysate (Cat# LY415173) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204747 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HOXD4
• Synonyms: HHO.C13; Hox-4.2; HOX-5.1; HOX4; HOX4B
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204747 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTCATGAGTTCGTATATGGTGAACTCCAAGTATGTGGACCCCAAGTTCCCTCCGTGCGAGGAGTATT
  TGCAGGGCGGCTACCTAGGCGAGCAGGGCGCCGACTACTACGGCGGCGGCGCGCAGGGCGCAGACTTCCA
  GCCCCCGGGGCTCTACCCACGGCCCGACTTCGGTGAGCAGCCTTTCGGAGGCAGCGGCCCCGGGCCTGGC
  TCGGCGCTGCCTGCGCGGGGTCACGGACAAGAGCCAGGCGGCCCCGGCGGTCACTACGCCGCTCCAGGAG
  AGCCTTGCCCAGCTCCCCCGGCGCCTCCGCCGGCGCCCCTGCCTGGCGCCCGGGCCTACAGTCAGTCCGA
  CCCCAAGCAGCCGCCCTCCGGGACGGCACTCAAGCAGCCGGCCGTGGTCTACCCCTGGATGAAGAAGGTG
  CACGTGAATTCGGTGAACCCCAACTACACCGGTGGGGAACCCAAGCGGTCCCGAACGGCCTACACCCGGC
  AGCAAGTCCTAGAACTGGAAAAAGAATTTCATTTTAACAGGTATCTGACAAGGCGCCGTCGGATTGAAAT
  CGCTCACACCCTGTGTCTGTCGGAGCGCCAGATCAAGATCTGGTTCCAGAACCGGAGGATGAAGTGGAAA
  AAAGATCATAAGCTGCCCAACACTAAAGGCAGGTCATCGTCCTCATCTTCCTCCTCATCTTGCTCCTCCT
  CAGTCGCCCCCAGCCAGCATTTACAGCCGATGGCCAAAGACCACCACACGGACCTGACGACCTTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204747 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPG
  SALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
  HVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWK
  KDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014621
• ORF Size: 765 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014621.1, NM_014621.2, NP_055436.1, NP_055436.2
• RefSeq Size: 1298 bp
• RefSeq ORF: 768 bp
• Locus ID: 3233
• Cytogenetics: 2q31.1
• Domains: homeobox
• Protein Families: Transcription Factors
• MW: 27.9 kDa
• Gene Summary: 'This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]'