TCIM (NM_020130) Human Tagged ORF Clone

CAT#: RC204798

C8orf4 (Myc-DDK-tagged)-Human chromosome 8 open reading frame 4 (C8orf4)


  "NM_020130" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "TCIM"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TCIM
Synonyms C8orf4; TC-1; TC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204798 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGCAAAGCGAAGCCACCAAGCCATCATCATGTCCACGTCGCTACGAGTCAGCCCATCCATCCATG
GCTACCACTTCGACACAGCCTCTCGTAAGAAAGCCGTGGGCAACATCTTTGAAAACACAGACCAAGAATC
ACTAGAAAGGCTCTTCAGAAACTCTGGAGACAAGAAAGCAGAGGAGAGAGCCAAGATCATTTTTGCCATA
GATCAAGATGTGGAGGAGAAAACGCGTGCCCTGATGGCCTTGAAGAAGAGGACAAAAGACAAGCTTTTCC
AGTTTCTGAAACTGCGGAAATATTCCATCAAAGTTCAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC204798 protein sequence
Red=Cloning site Green=Tags(s)

MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAI
DQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020130
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020130.1, NM_020130.2, NM_020130.3, NM_020130.4, NP_064515.1
RefSeq Size 1841 bp
RefSeq ORF 321 bp
Locus ID 56892
MW 12.4 kDa
Gene Summary This gene encodes a small, monomeric, predominantly unstructured protein that functions as a positive regulator of the Wnt/beta-catenin signaling pathway. This protein interacts with a repressor of beta-catenin mediated transcription at nuclear speckles. It is thought to competitively block interactions of the repressor with beta-catenin, resulting in up-regulation of beta-catenin target genes. The encoded protein may also play a role in the NF-kappaB and ERK1/2 signaling pathways. Expression of this gene may play a role in the proliferation of several types of cancer including thyroid cancer, breast cancer and hematological malignancies. [provided by RefSeq, Nov 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.