BCAS2 (NM_005872) Human Tagged ORF Clone

CAT#: RC205615

BCAS2 (Myc-DDK-tagged)-Human breast carcinoma amplified sequence 2 (BCAS2)

Product Images

Western blot validation of overexpression lysate (Cat# LY417014) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205615 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified BCAS2 protein (Cat# TP305615). The protein was produced from HEK293T cells transfected with BCAS2 cDNA clone (Cat# RC205615) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BCAS2
• Synonyms: DAM1; Snt309; SPF27
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205615 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGGCACAGGTTTGGTGGCTGGAGAGGTTGTGGTGGATGCGCTGCCGTATTTTGATCAAGGTTATG
  AAGCCCCTGGTGTGCGGGAAGCGGCTGCAGCGCTGGTGGAGGAGGAAACTCGCAGATACCGACCTACTAA
  GAACTACCTGAGCTACCTGACAGCCCCGGATTATTCTGCCTTTGAAACTGACATAATGAGAAATGAATTT
  GAAAGACTGGCTGCTCGACAACCAATTGAATTGCTCAGTATGAAACGATATGAGCTTCCAGCCCCCTCCT
  CTGGTCAAAAAAATGACATTACTGCATGGCAAGAATGTGTAAACAATTCTATGGCCCAGTTAGAGCATCA
  AGCAGTTAGAATTGAGAATCTGGAACTAATGTCACAGCATGGATGTAATGCCTGGAAAGTATACAATGAA
  AATCTAGTTCATATGATTGAACACGCACAGAAGGAACTTCAGAAGTTAAGAAAACATATTCAAGATTTAA
  ACTGGCAGAGAAAGAACATGCAACTCACAGCTGGATCTAAATTGAGAGAAATGGAGTCAAATTGGGTATC
  CCTGGTCAGTAAGAATTATGAGATTGAACGGACTATTGTTCAGCTAGAAAATGAAATCTATCAAATTAAG
  CAGCAACATGGAGAGGCAAACAAAGAAAACATCCGGCAAGACTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF
  ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE
  NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK
  QQHGEANKENIRQDF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005872
• ORF Size: 675 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005872.1, NM_005872.2, NP_005863.1
• RefSeq Size: 1310 bp
• RefSeq ORF: 678 bp
• Locus ID: 10286
• Protein Pathways: Spliceosome
• MW: 26.1 kDa
• Gene Summary: Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR). [UniProtKB/Swiss-Prot Function]