MAST4 (NM_198828) Human Tagged ORF Clone

CAT#: RC207706

MAST4 (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY404775) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC207706 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified MAST4 protein (Cat# TP307706). The protein was produced from HEK293T cells transfected with MAST4 cDNA clone (Cat# RC207706) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: MAST4
• Synonyms: DKFZp686E18148; DKFZp686N1467; FLJ16540; FLJ33039; KIAA0303
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC207706 representing NM_198828
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGGAGAAAGTTTCGGAGGCGCCAGAGCCGGTGCCCCGCGGCTGCAGTGGCCACGGCAGCCGGACTC
  CAGCCTCTGCGCTGGTCGCCGCGTCCTCTCCGGGTGCTTCCTCGGCCGAGTCCTCCTCGGGCTCAGAAAC
  TCTGTCGGAGGAAGGGGAGCCCGGCGGCTTCTCCAGAGAGCATCAGCCGCCGCCGCCGCCGCCGTTGGGA
  GGCACCCTGGGCGCCCGGGCGCCCGCCGCGTGGGCTCCGGCAAGCGTGCTGCTGGAGCGCGGAGTCCTTG
  CGCTGCCGCCGCCGCTTCCCGGAGGAGCTGTGCCGCCCGCGCCCCGGGGCAGCAGCGCGTCCCAGGAGGA
  GCAGGACGAGGAGCTTGACCACATATTATCCCCTCCACCCATGCCGTTTCGGAAATGCAGCAACCCAGAT
  GTGGCTTCTGGCCCTGGAAAATCACTGAAGTATAAAAGACAGCTGAGTGAGGATGGAAGACAGCTAAGGC
  GAGGGAGCCTGGGAGGAGCCCTGACTGGGAGGTACCTTCTTCCAAACCCGGTGGCGGGACAGGCCTGGCC
  GGCCTCTGCAGAGACGTCCAACCTCGTGCGCATGCGCAGCCAGGCCCTGGGCCAGTCGGCGCCCTCGCTC
  ACCGCCAGCCTGAAGGAGCTGAGTCTCCCCAGAAGAGGAAGTTTGATAGATTCCCAGAAGTGGAATTGCT
  TGGTCAAACGCCCTGTGTGTCCAAATGCTGGGAGAACATCACCCCTTGGA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC207706 representing NM_198828
  Red=Cloning site Green=Tags(s)
  
  MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG
  GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD
  VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL
  TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_198828
• ORF Size: 750 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_198828.1, NM_198828.2, NP_942123.1
• RefSeq Size: 1105 bp
• RefSeq ORF: 753 bp
• Locus ID: 375449
• Protein Families: Druggable Genome, Protein Kinase
• MW: 25.5 kDa
• Gene Summary: This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]