Histone H3.3C (H3F3C) (NM_001013699) Human Tagged ORF Clone

CAT#: RC209730

H3F3C (Myc-DDK-tagged)-Human H3 histone, family 3C (H3F3C)


  "NM_001013699" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "H3-5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol H3-5
Synonyms H3.5; H3F3C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209730 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGAACCAAGCAGACTGCTCGTAAATCCACCGGTGGGAAAGCCCCCCGCAAACAGCTGGCCACGA
AAGCTGCCAGGAAAAGCACCCCCTCTACCTGCGGGGTGAAGCCTCATCGCTACAGGCCTGGGACCGTGGC
GCTTCGAGAGATTCGTCGTTATCAGAAGTCGACCGAGCTGCTCATCCGGAAGCTGCCCTTCCAGAGGTTG
GTGAGGGAGATCGCGCAGGATTTCAACACTGACCTGAGGTTTCAGAGCGCAGTCGTCGGTGCGCTGCAGG
AGGCTAGCGAAGCGTACCTGGTGGGTCTGTTGGAAGATACTAACCTGTGTGCCATCCACGCTAAGAGAGT
CACCATCATGCCCAAAGACATCCAGTTGGCTCGCCGGATACGGGGAGAGAGAGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209730 protein sequence
Red=Cloning site Green=Tags(s)

MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL
VREIAQDFNTDLRFQSAVVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001013699
ORF Size 405 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001013699.1, NM_001013699.2, NP_001013721.1
RefSeq Size 1071 bp
RefSeq ORF 408 bp
Locus ID 440093
Cytogenetics 12p11.21
Protein Pathways Systemic lupus erythematosus
MW 15.2 kDa
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. [provided by RefSeq, Oct 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.