MRP63 (MRPL57) (NM_024026) Human Tagged ORF Clone

CAT#: RC209765

MRP63 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein 63 (MRP63), nuclear gene encoding mitochondrial protein

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: MRPL57
• Synonyms: bMRP63; MRP63
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC209765 representing NM_024026
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTCCTGACTGCGCTCCTCTGGCGCGGCCGCATTCCCGGCCGTCAGTGGATCGGGAAGCACCGGCGGC
  CGCGGTTCGTGTCGTTGCGCGCCAAGCAGAACATGATCCGCCGCCTGGAGATCGAGGCGGAGAACCATTA
  CTGGCTGAGCATGCCCTACATGACCCGGGAGCAGGAGCGCGGCCACGCCGCGGTGCGCAGGAGGGAGGCC
  TTCGAGGCCATAAAGGCGGCCGCCACTTCCAAGTTCCCCCCGCATAGATTCATTGCGGACCAGCTCGACC
  ATCTCAATGTCACCAAGAAATGGTCC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC209765 representing NM_024026
  Red=Cloning site Green=Tags(s)
  
  MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREA
  FEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_024026
• ORF Size: 306 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_024026.1, NM_024026.2, NM_024026.3, NM_024026.4, NP_076931.1
• RefSeq Size: 2671
• RefSeq ORF: 309
• Locus ID: 78988
• MW: 12.1 kDa
• Gene Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein which belongs to an undetermined ribosomal subunit and which seems to be specific to animal mitoribosomes. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 3p, 5q, 8q, 14q, and Y. [provided by RefSeq, Jul 2008]