CXCL11 (NM_005409) Human Tagged ORF Clone
CAT#: RC210320
- TrueORF®
CXCL11 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 11 (CXCL11)
"NM_005409" in other vectors (6)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CXCL11 |
Synonyms | b-R1; H174; I-TAC; IP-9; IP9; SCYB9B; SCYB11 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210320 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTGTGAAGGGCATGGCTATAGCCTTGGCTGTGATATTGTGTGCTACAGTTGTTCAAGGCTTCCCCA TGTTCAAAAGAGGACGCTGTCTTTGCATAGGCCCTGGGGTAAAAGCAGTGAAAGTGGCAGATATTGAGAA AGCCTCCATAATGTACCCAAGTAACAACTGTGACAAAATAGAAGTGATTATTACCCTGAAAGAAAATAAA GGACAACGATGCCTAAATCCCAAATCGAAGCAAGCAAGGCTTATAATCAAAAAAGTTGAAAGAAAGAATT TT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210320 protein sequence
Red=Cloning site Green=Tags(s) MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK GQRCLNPKSKQARLIIKKVERKNF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005409 |
ORF Size | 282 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005409.1, NM_005409.2, NM_005409.3, NM_005409.4, NP_005400.1 |
RefSeq Size | 1610 bp |
RefSeq ORF | 285 bp |
Locus ID | 6373 |
Cytogenetics | 4q21.1 |
Domains | IL8 |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway |
MW | 10.4 kDa |
Gene Summary | 'Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC116746 | CXCL11 (untagged)-Human chemokine (C-X-C motif) ligand 11 (CXCL11) |
USD 310.00 |
|
RG210320 | CXCL11 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 11 (CXCL11) |
USD 460.00 |
|
RC210320L1 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), Myc-DDK-tagged |
USD 768.00 |
|
RC210320L2 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), mGFP tagged |
USD 620.00 |
|
RC210320L3 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), Myc-DDK-tagged |
USD 768.00 |
|
RC210320L4 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 11 (CXCL11), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review