OTUB1 (NM_017670) Human Tagged ORF Clone

CAT#: RC210648

OTUB1 (Myc-DDK-tagged)-Human OTU domain, ubiquitin aldehyde binding 1 (OTUB1), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY402607) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC210648 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified OTUB1 protein (Cat# TP310648). The protein was produced from HEK293T cells transfected with OTUB1 cDNA clone (Cat# RC210648) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: OTUB1
• Synonyms: HSPC263; OTB1; OTU1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC210648 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGCGGAGGAACCTCAGCAGCAGAAGCAGGAGCCGCTGGGCAGCGACTCCGAAGGTGTTAACTGTC
  TGGCCTATGATGAAGCCATCATGGCTCAGCAGGACCGAATTCAGCAAGAGATTGCTGTGCAGAACCCTCT
  GGTGTCAGAGCGGCTGGAGCTCTCGGTCCTATACAAGGAGTATGCTGAAGATGACAACATCTATCAACAG
  AAGATCAAGGACCTCCACAAAAAGTACTCGTACATCCGCAAGACCAGGCCTGACGGCAACTGTTTCTATC
  GGGCTTTCGGATTCTCCCACTTGGAGGCACTGCTGGATGACAGCAAGGAGTTGCAGCGGTTCAAGGCTGT
  GTCTGCCAAGAGCAAGGAAGACCTGGTGTCCCAGGGCTTCACTGAATTCACAATTGAGGATTTCCACAAC
  ACGTTCATGGACCTGATTGAGCAGGTGGAGAAGCAGACCTCTGTCGCCGACCTGCTGGCCTCCTTCAATG
  ACCAGAGCACCTCCGACTACCTTGTGGTCTACCTGCGGCTGCTCACCTCGGGCTACCTGCAGCGCGAGAG
  CAAGTTCTTCGAGCACTTCATCGAGGGTGGACGGACTGTCAAGGAGTTCTGCCAGCAGGAGGTGGAGCCC
  ATGTGCAAGGAGAGCGACCACATCCACATCATTGCGCTGGCCCAGGCCCTCAGCGTGTCCATCCAGGTGG
  AGTACATGGACCGCGGCGAGGGCGGCACCACCAATCCGCACATCTTCCCTGAGGGCTCCGAGCCCAAGGT
  CTACCTTCTCTACCGGCCTGGACACTACGATATCCTCTACAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC210648 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQ
  KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHN
  TFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEP
  MCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_017670
• ORF Size: 813 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq Size: 2310 bp
• RefSeq ORF: 816 bp
• Locus ID: 55611
• Protein Families: Protease
• MW: 31.3 kDa
• Gene Summary: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]