PCDHGC3 (NM_032403) Human Tagged ORF Clone
CAT#: RC211429
- TrueORF®
PCDHGC3 (Myc-DDK-tagged)-Human protocadherin gamma subfamily C, 3 (PCDHGC3), transcript variant 3
"NM_032403" in other vectors (4)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PCDHGC3 |
Synonyms | PC43; PCDH-GAMMA-C3; PCDH2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC211429 representing NM_032403
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTCCCAGAGGCCTGGAGGAGCGGACTGCAAGCCCCGCCCAACACGGACTGGCGTTTCTCTCAGGCCC AGAGACCCGGCACCAGCGGCTCCCAAAATGGCGATGACACCGGCACCTGGCCCAACAACCAGTTTGACAC AGAGATGCTGCAAGCCATGATCTTGGCGTCCGCCAGTGAAGCTGCTGATGGGAGCTCCACCCTGGGAGGG GGTGCCGGCACCATGGGATTGAGCGCCCGCTACGGACCCCAGTTCACCCTGCAGCACGTGCCCGACTACC GCCAGAATGTCTACATCCCAGGCAGCAATGCCACACTGACCAACGCAGCTGGCAAGCGGGATGGCAAGGC CCCAGCAGGTGGCAATGGCAACAAGAAGAAGTCGGGCAAGAAGGAGAAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC211429 representing NM_032403
Red=Cloning site Green=Tags(s) MVPEAWRSGLQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGG GAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_032403 |
ORF Size | 402 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032403.1, NM_032403.2, NP_115779.1 |
RefSeq Size | 2326 bp |
RefSeq ORF | 405 bp |
Locus ID | 5098 |
Cytogenetics | 5q31.3 |
Protein Families | Transmembrane |
MW | 13.9 kDa |
Gene Summary | 'This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC310676 | TrueClone®, PCDHGC3 (untagged)-Human protocadherin gamma subfamily C, 3 (PCDHGC3), transcript variant 3 |
USD 540.00 |
|
RG211429 | PCDHGC3 (GFP-tagged) - Human protocadherin gamma subfamily C, 3 (PCDHGC3), transcript variant 3 |
USD 460.00 |
|
RC211429L3 | Lenti-ORF clone of PCDHGC3 (Myc-DDK-tagged)-Human protocadherin gamma subfamily C, 3 (PCDHGC3), transcript variant 3 |
USD 620.00 |
|
RC211429L4 | Lenti-ORF clone of PCDHGC3 (mGFP-tagged)-Human protocadherin gamma subfamily C, 3 (PCDHGC3), transcript variant 3 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review