KCNIP4 (NM_001035003) Human Tagged ORF Clone

CAT#: RC211661

  • TrueORF®

KCNIP4 (Myc-DDK-tagged)-Human Kv channel interacting protein 4 (KCNIP4), transcript variant 5


  "NM_001035003" in other vectors (4)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "KCNIP4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNIP4
Synonyms CALP; KCHIP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211661 representing NM_001035003
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGCTGTAGAAAGCGGTGTAAACGTGAAATACTGAAATTTGCCCAGTACCTTCTCAGACTATTAA
CAGGTTCTCTTCATACAGACAGCGTGGAAGATGAACTGGAGATGGCCACCGTCAGGCATCGGCCTGAAGC
CCTTGAGCTTCTGGAAGCCCAGAGCAAATTTACCAAGAAAGAGCTTCAGATCCTTTACAGAGGATTTAAG
AATGAATGCCCCAGTGGTGTTGTTAATGAAGAAACCTTCAAAGAGATTTACTCGCAGTTCTTTCCACAGG
GAGACTCTACAACATATGCACATTTTCTGTTCAATGCATTTGATACAGACCACAATGGAGCTGTGAGTTT
CGAGGATTTCATCAAAGGTCTTTCCATTTTGCTCCGGGGGACAGTACAAGAAAAACTCAATTGGGCATTT
AATCTGTATGACATAAATAAAGATGGCTACATCACTAAAGAGGAAATGCTTGATATAATGAAAGCAATAT
ACGATATGATGGGTAAATGTACATATCCTGTCCTCAAAGAAGATGCTCCCAGACAACACGTTGAAACATT
TTTTCAGAAAATGGACAAAAATAAAGATGGGGTTGTTACCATAGATGAGTTCATTGAAAGCTGCCAAAAA
GATGAAAACATAATGCGCTCCATGCAGCTCTTTGAAAATGTGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211661 representing NM_001035003
Red=Cloning site Green=Tags(s)

MSGCRKRCKREILKFAQYLLRLLTGSLHTDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFK
NECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAF
NLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQK
DENIMRSMQLFENVI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001035003
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001035003.1, NP_001030175.1
RefSeq Size 2424 bp
RefSeq ORF 678 bp
Locus ID 80333
Cytogenetics 4p15.31-p15.2
Protein Families Druggable Genome, Ion Channels: Other
MW 26.1 kDa
Gene Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.