DIO2 (NM_013989) Human Tagged ORF Clone
CAT#: RC214679
- TrueORF®
DIO2 (Myc-DDK-tagged)-Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (Note, selenocysteine protein, internal stop codon, see reference data summary)
"NM_013989" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Symbol | DIO2 |
Synonyms | 5DII; D2; DIOII; SelY; TXDI2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC214679 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCATCCTCAGCGTAGACTTGCTGATCACACTGCAAATTCTGCCAGTTTTTTTCTCCAACTGCCTCT TCCTGGCTCTCTATGACTCGGTCATTCTGCTCAAGCACGTGGTGCTGCTGTTGAGCCGCTCCAAGTCCAC TCGCGGAGAGTGGCGGCGCATGCTGACCTCAGAGGGACTGCGCTGCGTCTGGAAGAGCTTCCTCCTCGAT GCCTACAAACAGGTGAAATTGGGTGAGGATGCCCCCAATTCCAGTGTGGTGCATGTCTCCAGTACAGAAG GAGGTGACAACAGTGGCAATGGTACCCAGGAGAAGATAGCTGAGGGAGCCACATGCCACCTTCTTGACTT TGCCAGCCCTGAGCGCCCACTAGTGGTCAACTTTGGCTCAGCCACTTGACCTCCTTTCACGAGCCAGCTG CCAGCCTTCCGCAAACTGGTGGAAGAGTTCTCCTCAGTGGCTGACTTCCTGCTGGTCTACATTGATGAGG CTCATCCATCAGATGGCTGGGCGATACCGGGGGACTCCTCTTTGTCTTTTGAGGTGAAGAAGCACCAGAA CCAGGAAGATCGATGTGCAGCAGCCCAGCAGCTTCTGGAGCGTTTCTCCTTGCCGCCCCAGTGCCGAGTT GTGGCTGACCGCATGGACAATAACGCCAACATAGCTTACGGGGTAGCCTTTGAACGTGTGTGCATTGTGC AGAGACAGAAAATTGCTTATCTGGGAGGAAAGGGCCCCTTCTCCTACAACCTTCAAGAAGTCCGGCATTG GCTGGAGAAGAATTTCAGCAAGAGATGAAAGAAAACTAGATTAGCTGGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC214679 protein sequence
Red=Cloning site Green=Tags(s) MGILSVDLLITLQILPVFFSNCLFLALYDSVILLKHVVLLLSRSKSTRGEWRRMLTSEGLRCVWKSFLLD AYKQVKLGEDAPNSSVVHVSSTEGGDNSGNGTQEKIAEGATCHLLDFASPERPLVVNFGSAT*PPFTSQL PAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRV VADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKR*KKTRLAG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_013989 |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. |
OTI Annotation | This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_013989.1, NM_013989.2, NM_013989.3, NM_013989.4, NP_054644.1 |
RefSeq Size | 6148 bp |
RefSeq ORF | 822 bp |
Locus ID | 1734 |
Cytogenetics | 14q31.1 |
Protein Families | Druggable Genome |
Gene Summary | 'The protein encoded by this gene belongs to the iodothyronine deiodinase family. It catalyzes the conversion of prohormone thyroxine (3,5,3',5'-tetraiodothyronine, T4) to the bioactive thyroid hormone (3,5,3'-triiodothyronine, T3) by outer ring 5'-deiodination. This gene is widely expressed, including in thyroid and brain. It is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. It has also been reported to be highly expressed in thyroids of patients with Graves disease, and in follicular adenomas. The intrathyroidal T4 to T3 conversion by this enzyme may contribute significantly to the relative increase in thyroidal T3 production in these patients. This protein is a selenoprotein containing the non-standard amino acid, selenocysteine (Sec), which is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Unlike the other two members (DIO1 and DIO3) of this enzyme family, the mRNA for this gene contains an additional in-frame UGA codon that has been reported (in human) to function either as a Sec or a stop codon, which can result in two isoforms with one or two Sec residues; however, only the upstream Sec (conserved with the single Sec residue found at the active site in DIO1 and DIO3) was shown to be essential for enzyme activity (PMID:10403186). Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2018]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC124708 | DIO2 (untagged)-Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
USD 660.00 |
|
RG214679 | DIO2 (GFP-tagged) - Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
USD 460.00 |
|
RC214679L1 | Lenti-ORF, DIO2 (Myc-DDK-tagged)-Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary) |
USD 768.00 |
|
RC214679L2 | Lenti-ORF, DIO2 (mGFP-tagged) - Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (Note: selenocystein protein, Internal stop codon present. See Summary below) |
USD 620.00 |
|
RC214679L3 | Lenti-ORF, DIO2 (Myc-DDK-tagged)-Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary) |
USD 768.00 |
|
RC214679L4 | Lenti-ORF, DIO2 (mGFP-tagged) - Human deiodinase, iodothyronine, type II (DIO2), transcript variant 1, (Note: selenocystein protein, Internal stop codon present. See Summary below) |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review