LST1 (NM_205837) Human Tagged ORF Clone

CAT#: RC215263

LST1 (Myc-DDK-tagged)-Human leukocyte specific transcript 1 (LST1), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LST1
• Synonyms: B144; D6S49E; LST-1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC215263 representing NM_205837
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTATCGCGGAATGATGATATATGTATCTACGGGGGCCTGGGGCTGGGCGGGCTCCTGCTTCTGGCAG
  TGGTCCTTCTGTCCGCCTGCCTGTGTTGGCTGCATCGAAGAGCACCTTCTGTCCTGGTCCCAGGCCCAGG
  GCTCCTCAGAGCAGGAACTCCACTATGCATCTCTGCAGAGGCTGCCAGTGCCCAGCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC215263 representing NM_205837
  Red=Cloning site Green=Tags(s)
  
  MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRAPSVLVPGPGLLRAGTPLCISAEAASAQQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_205837
• ORF Size: 198 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_205837.2, NP_995309.2
• RefSeq Size: 739
• RefSeq ORF: 201
• Locus ID: 7940
• Protein Families: Transmembrane
• MW: 6.8 kDa
• Gene Summary: The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]