ANP32D (NM_012404) Human Tagged ORF Clone

CAT#: RC216023

ANP32D (Myc-DDK-tagged)-Human acidic (leucine-rich) nuclear phosphoprotein 32 family, member D (ANP32D)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ANP32D
• Synonyms: PP32R2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC216023 representing NM_012404
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGATGGGCAAATGGATTCATTTAGAGCTGCGGAACAGGACGCCCTCCGATGTGAAAGAACTTTTCC
  TGGACAACAGTCAGTCAAATGAAGGCAAATTGGAAGGCCTCACAGATGAATTTGAAGAACTGGAATTATT
  AAATACAATCAACATAGGCCTCACCTCAATTGCAAACTTGCCAAAGTTAAACAAACTTAAGAAGCTTGAA
  CTAAGCAGTAACAGAGCCTCAGTGGGCCTAGAAGTATTGGCAGAAAAGTGTCCAAACCTCATACATCTAA
  ATTTAAGTGGCAACAAAATTAAAGACCTCAGCACAATAGAGCCCCTGAAAAAGTTAGAAAACCTCGAGAG
  CTTAGACCTTTTCACTTGCGAGGTAACCAACCTGAACAACTAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC216023 representing NM_012404
  Red=Cloning site Green=Tags(s)
  
  MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANLPKLNKLKKLE
  LSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDLFTCEVTNLNNY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_012404
• ORF Size: 393 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_012404.1, NM_012404.2, NP_036536.2
• RefSeq Size: 396
• RefSeq ORF: 396
• Locus ID: 23519
• Domains: LRR
• MW: 14.6 kDa
• Gene Summary: Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is absent in the protein encoded by this gene. This gene does not contain introns. [provided by RefSeq, Jul 2008]