TAF9B (NM_015975) Human Tagged ORF Clone

CAT#: RC217413

TAF9B (Myc-DDK-tagged)-Human TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa (TAF9B)

Product Images

Western blot validation of overexpression lysate (Cat# LY414266) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC217413 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TAF9B
• Synonyms: DN-7; DN7; TAF9L; TAFII31L; TFIID-31
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC217413 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGTCGGGCAAGATGGCGCCTCCCAAGAACGCTCCGAGAGATGCCTTGGTGATGGCACAGATCCTGA
  AGGATATGGGAATCACAGAGTATGAACCAAGGGTTATAAATCAAATGTTGGAATTTGCTTTCCGTTATGT
  GACTACAATTCTGGATGATGCAAAAATTTATTCGAGCCATGCTAAGAAACCTAATGTTGATGCAGATGAT
  GTGAGACTGGCAATCCAGTGTCGTGCTGACCAATCTTTTACCTCTCCTCCCCCAAGAGATTTTTTACTGG
  ATATCGCAAGGCAGAAAAATCAAACCCCTTTGCCACTGATTAAGCCATATGCAGGACCTAGACTGCCACC
  TGATAGATACTGCTTAACAGCTCCAAACTATAGGCTGAAGTCCTTAATTAAAAAGGGACCTAACCAAGGG
  AGACTAGTTCCACGATTAAGTGTTGGTGCTGTTAGTAGCAAACCTACTACTCCTACTATAGCAACCCCAC
  AAACGGTGTCTGTCCCAAATAAAGTTGCAACTCCAATGTCAGTGACAAGCCAAAGATTTACGGTGCAGAT
  TCCACCTTCTCAGTCCACACCTGTCAAACCAGTTCCTGCAACAACTGCAGTTCAAAATGTTCTGATTAAT
  CCTTCAATGATTGGGCCCAAAAATATTCTTATTACCACCAACATGGTTTCGTCACAGAACACAGCCAATG
  AAGCAAACCCACTGAAGAGAAAACATGAAGATGATGATGACAATGATATTATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC217413 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADD
  VRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQG
  RLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLIN
  PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_015975
• ORF Size: 753 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_015975.2, NM_015975.3, NM_015975.4, NP_057059.2
• RefSeq Size: 2714 bp
• RefSeq ORF: 756 bp
• Locus ID: 51616
• Domains: TFIID-31
• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors
• MW: 27.6 kDa
• Gene Summary: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process. [provided by RefSeq, Jul 2008]