RAD51D (NM_133629) Human Tagged ORF Clone

CAT#: RC217466

  • TrueORF®

RAD51D (Myc-DDK-tagged)-Human RAD51-like 3 (S. cerevisiae) (RAD51L3), transcript variant 4


  "NM_133629" in other vectors (4)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "RAD51D"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAD51D
Synonyms BROVCA4; R51H3; RAD51L3; TRAD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217466 representing NM_133629
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGTGCTCAGGGTCGGACTGTGCCCTGGCCTTACCGAGGAGATGATCCAGCTTCTCAGGAGCCACA
GGATCAAGACAGTGGTGGACCTGGTTTCTGCAGACCTGGAAGAGGTAGCTCAGAAATGTGGCTTGTCTTA
CAAGGCAGAAGCTCTCCGGAGGATCCAGGTGGTGCATGCATTTGACATCTTCCAGATGCTGGATGTGCTG
CAGGAGCTCCGAGGCACTGTGGCCCAGCAGGTGACTGGTTCTTCAGGAACTGTGAAGGTGGTGGTTGTGG
ACTCGGTCACTGCGGTGGTTTCCCCACTTCTGGGAGGTCAGCAGAGGGAAGGCTTGGCCTTGATGATGCA
GCTGGCCCGAGAGCTGAAGACCCTGGCCCGGGACCTTGGCATGGCAGTGGTGGTGACCAACCACATAACT
CGAGACAGGGACAGCGGGAGGCTCAAACCTGCCCTCGGACGCTCCTGGAGCTTTGTGCCCAGCACTCGGA
TTCTCCTGGACACCATCGAGGGAGCAGGAGCATCAGGCGGCCGGCGCATGGCGTGTCTGGCCAAATCTTC
CCGACAGCCAACAGGTTTCCAGGAGATGGTAGACATTGGGACCTGGGGGACCTCAGAGCAGAGTGCCACA
TTACAGGGTGATCAGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217466 representing NM_133629
Red=Cloning site Green=Tags(s)

MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKAEALRRIQVVHAFDIFQMLDVL
QELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHIT
RDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSAT
LQGDQT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133629
ORF Size 648 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_133629.1, NM_133629.2, NP_598332.1
RefSeq Size 1477 bp
RefSeq ORF 651 bp
Locus ID 5892
Cytogenetics 17q12
Domains ENDO3c
Protein Families Druggable Genome
Protein Pathways Homologous recombination
MW 23.1 kDa
Gene Summary 'The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This protein forms a complex with several other members of the RAD51 family, including RAD51L1, RAD51L2, and XRCC2. The protein complex formed with this protein has been shown to catalyze homologous pairing between single- and double-stranded DNA, and is thought to play a role in the early stage of recombinational repair of DNA. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream ring finger and FYVE-like domain containing 1 (RFFL) gene. [provided by RefSeq, Jan 2011]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.