CACNG7 (NM_031896) Human Tagged ORF Clone

CAT#: RC224084

CACNG7 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 7 (CACNG7)

Product Images

Western blot validation of overexpression lysate (Cat# LY403128) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC224084 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CACNG7
• Synonyms: calcium channel, voltage-dependent, gamma subunit 7; neuronal voltage-gated calcium channel gamma-7 subunit; OTTHUMP00000067298; voltage-dependent calcium channel gamma-7 subunit
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC224084 representing NM_031896
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTCACTGCAGCAGCCGCGCCCTGACCCTGCTGAGCAGCGTGTTTGGTGCGTGTGGCCTGCTCCTGG
  TAGGCATCGCGGTCAGCACTGACTACTGGCTGTACATGGAAGAAGGCACAGTGCTACCGCAGAACCAGAC
  CACCGAGGTCAAGATGGCCCTGCACGCCGGCCTCTGGCGAGTCTGCTTCTTTGCAGGTCGGGAGAAAGGT
  CGCTGTGTGGCCTCAGAATATTTTCTTGAACCGGAGATCAATTTGGTGACGGAAAACACGGAGAATATTC
  TGAAGACAGTGCGCACGGCCACCCCCTTCCCCATGGTCAGCCTCTTCCTCGTGTTCACGGCCTTCGTCAT
  CAGCAACATCGGCCACATCCGCCCGCAGAGGACCATTCTGGCTTTTGTCTCTGGCATCTTCTTCATACTA
  TCGGGCCTCTCCTTGGTGGTGGGCTTGGTTCTTTACATCTCCAGCATCAACGACGAGGTCATGAACAGGC
  CCAGCAGCTCTGAGCAGTATTTTCATTATCGCTACGGGTGGTCTTTTGCCTTCGCCGCTTCCTCCTTCCT
  ACTCAAAGAGGGGGCCGGCGTGATGTCCGTGTACCTGTTCACCAAGCGCTACGCGGAGGAGGAGATGTAC
  CGTCCACACCCGGCCTTCTACCGCCCGCGTCTCAGCGACTGCTCCGACTACTCGGGCCAGTTCCTGCAGC
  CCGAGGCGTGGCGCCGCGGCCGGAGCCCCTCCGACATCTCCAGCGACGTGTCCATCCAAATGACGCAGAA
  CTACCCTCCCGCCATCAAGTACCCGGACCACCTGCACATCTCCACCTCGCCCTGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC224084 representing NM_031896
  Red=Cloning site Green=Tags(s)
  
  MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKG
  RCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFIL
  SGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMY
  RPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_031896
• ORF Size: 825 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_031896.2, NM_031896.3, NM_031896.4, NP_114102.2
• RefSeq Size: 1564 bp
• RefSeq ORF: 828 bp
• Locus ID: 59284
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway
• MW: 30.8 kDa
• Gene Summary: The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]