Troponin T1 (TNNT1) (NM_001126133) Human Tagged ORF Clone

CAT#: RC225325

TNNT1 (Myc-DDK-tagged)-Human troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 3

Product Images

Western blot validation of overexpression lysate (Cat# LY426666) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC225325 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TNNT1
• Synonyms: ANM; NEM5; STNT; TNT; TNTS
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC225325 representing NM_001126133
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGGACACCGAGGAGCAGGAATATGAGGAGGAGCAGCCGGAAGAGGAGGCTGCGGAGGAGGAGGAGG
  AAGAAGAGGAACGCCCCAAACCAAGCCGCCCCGTGGTGCCTCCTTTGATCCCGCCAAAGATCCCAGAAGG
  GGAGCGCGTTGACTTCGATGACATCCACCGCAAGCGCATGGAGAAAGACCTGCTGGAGCTGCAGACACTC
  ATCGATGTACATTTCGAGCAGCGGAAGAAGGAGGAAGAGGAGCTGGTTGCCTTGAAGGAGCGCATTGAGC
  GGCGCCGGTCAGAGAGAGCCGAGCAACAGCGCTTCAGAACTGAGAAGGAACGCGAACGTCAGGCTAAGCT
  GGCGGAGGAGAAGATGAGGAAGGAAGAGGAAGAGGCCAAGAAGCGGGCAGAGGATGATGCCAAGAAAAAG
  AAGGTGCTGTCCAACATGGGGGCCCATTTTGGCGGCTACCTGGTCAAGGCAGAACAGAAGCGTGGTAAGC
  GGCAGACGGGGCGGGAGATGAAGGTGCGCATCCTCTCCGAGCGTAAGAAGCCTCTGGACATTGACTACAT
  GGGGGAGGAACAGCTCCGGGAGAAAGCCCAGGAGCTGTCGGACTGGATCCACCAGCTGGAGTCTGAGAAG
  TTCGACCTGATGGCGAAGCTGAAACAGCAGAAATATGAGATCAACGTGCTGTACAACCGCATCAGCCACG
  CCCAGAAGTTCCGGAAGGGGGCAGGGAAGGGCCGCGTTGGAGGCCGCTGGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC225325 representing NM_001126133
  Red=Cloning site Green=Tags(s)
  
  MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTL
  IDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKK
  KVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEK
  FDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001126133
• ORF Size: 753 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001126133.1, NM_001126133.2, NP_001119605.1
• RefSeq ORF: 756 bp
• Locus ID: 7138
• Cytogenetics: 19q13.42
• Protein Families: Druggable Genome
• MW: 29.9 kDa
• Gene Summary: 'This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]'