CD299 (CLEC4M) (NM_001144908) Human Tagged ORF Clone

CAT#: RC227293

CLEC4M (Myc-DDK-tagged)-Human C-type lectin domain family 4, member M (CLEC4M), transcript variant 10

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CLEC4M
• Synonyms: CD209L; CD299; DC-SIGN2; DC-SIGNR; DCSIGNR; HP10347; L-SIGN; LSIGN
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC227293 representing NM_001144908
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTGACTCCAAGGAACCAAGGGTGCAGCAGCTGGGCCTCCTGGAAGAAGATCCAACAACCAGTGGCA
  TCAGACTTTTTCCAAGAGACTTTCAATTCCAGCAGATACATGGCCACAAGAGCTCTACAGGGTGTCTTGG
  CCATGGCGCCCTGGTGCTGCAACTCCTCTCCTTCATGCTCTTGGCTGGGGTCCTGGTGGCCATCCTTGTC
  CAAGTGTCCAAGGTCCCCAGCTCCCTAAGTCAGGAACAATCCGAGCAAGACGCAATCTACCAGAACCTGA
  CCCAGCTTAAAGCTGCAGTGGGTGAGCTCTCAGAGAAATCCAAGCTGCAGGAGATCTACCAGGAGCTGAC
  CCAGCTGAAGGCTGCAGTGGGTGAGTTGCCAGAGAAATCCAAGCTGCAGGAGATCTACCAGGAGCTGACC
  CGGCTGAAGGCTGCAGTGGGTGAGTTGCCAGAGAAATCCAAGCTGCAGGAGATCTACCAGGAGCTGACCC
  GGCTGAAGGCTGCAGTGGAACGCCTGTGCCGCCACTGTCCCAAGGACTGGACATTCTTCCAAGGAAACTG
  TTACTTCATGTCTAACTCCCAGCGGAACTGGCACGACTCCGTCACCGCCTGCCAGGAAGTGAGGGCCCAG
  CTCGTCGTAATCAAAACTGCTGAGGAGCAGCTTCCAGCGGTACTGGAACAGTGGAGAACCCAACAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC227293 representing NM_001144908
  Red=Cloning site Green=Tags(s)
  
  MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILV
  QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELT
  RLKAAVGELPEKSKLQEIYQELTRLKAAVERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQ
  LVVIKTAEEQLPAVLEQWRTQQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001144908
• ORF Size: 696 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001144908.1, NP_001138380.1
• RefSeq ORF: 699
• Locus ID: 10332
• Protein Families: Druggable Genome, Transmembrane
• MW: 26.1 kDa
• Gene Summary: This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants. [provided by RefSeq, Feb 2009]