EAAT1 (SLC1A3) (NM_001166696) Human Tagged ORF Clone
CAT#: RC229494
- TrueORF®
SLC1A3 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 3 (SLC1A3), transcript variant 3
"NM_001166696" in other vectors (4)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SLC1A3 |
Synonyms | EA6; EAAT1; GLAST; GLAST1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC229494 representing NM_001166696
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTAAAAGCAATGGAGAAGAGCCCAAGATGGGGGGCAGGATGGAGAGATTCCAGCAGGGAGTCCGTA AACGCACACTTTTGGCCAAGAAGAAAGTGCAGAACATTACAAAGGAGGATGTTAAAAGTTACCTGTTTCG GAATGCTTTTGTGCTGCTCACAGTCACCGCTGTCATTGTGGGTGAGTCATTTGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229494 representing NM_001166696
Red=Cloning site Green=Tags(s) MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGESFD myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001166696 |
ORF Size | 195 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001166696.1, NM_001166696.2, NP_001160168.1 |
RefSeq ORF | 198 bp |
Locus ID | 6507 |
Cytogenetics | 5p13.2 |
Protein Families | Transmembrane |
MW | 7.9 kDa |
Gene Summary | 'This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2014]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC328132 | SLC1A3 (untagged)-Human solute carrier family 1 (glial high affinity glutamate transporter) member 3 (SLC1A3) transcript variant 3 |
USD 420.00 |
|
RG229494 | SLC1A3 (GFP-tagged) - Human solute carrier family 1 (glial high affinity glutamate transporter), member 3 (SLC1A3), transcript variant 3 |
USD 460.00 |
|
RC229494L3 | Lenti-ORF clone of SLC1A3 (Myc-DDK-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 3 (SLC1A3), transcript variant 3 |
USD 620.00 |
|
RC229494L4 | Lenti-ORF clone of SLC1A3 (mGFP-tagged)-Human solute carrier family 1 (glial high affinity glutamate transporter), member 3 (SLC1A3), transcript variant 3 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review