CINP (NM_001177612) Human Tagged ORF Clone

CAT#: RC229552

  • TrueORF®

CINP (Myc-DDK-tagged)-Human cyclin-dependent kinase 2 interacting protein (CINP), transcript variant 3


  "NM_001177612" in other vectors (4)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "CINP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CINP
Synonyms MGC849
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229552 representing NM_001177612
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGCAAAGACTCTTGGAACTGTAACGCCCAGAAAACCTGTCTTATCTGTCAGTGCAAGAAAAATTA
AGGACAATGCGGCTGATTGGCACAATTTAATCCTGAAGTGGGAAACCCTCAATGATGCAGGTTTTACCAC
TGCAAATAATATTGCCAACTTGAAAATCAGTTTATTGAATAAAGACAAGATAGAACTAGACAGCAGCAGC
CCAGCCTCGAAGGAAAATGAAGAAAAGGTGTGTCTGGAATATAACGAGGAACTGGAGAAGCTGTGTGAGG
AACTGCAGGCCACCTTGGATGGGTTGATGAGGTTTCGCATAAGCTCTTGGAGATGTACAGGAAGGAGCTG
CTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229552 representing NM_001177612
Red=Cloning site Green=Tags(s)

MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS
PASKENEEKVCLEYNEELEKLCEELQATLDGLMRFRISSWRCTGRSCS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001177612
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001177612.1, NP_001171083.1
RefSeq ORF 356
Locus ID 51550
Protein Families Druggable Genome
MW 13.7 kDa
Gene Summary The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.